PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001541G0130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 295aa    MW: 32833 Da    PI: 7.6423
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001541G0130genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l++ ++++G+g +W + +++ g++R++k+c++rw++yl
  PH01001541G0130 14 KGPWSPEEDAKLKEFIEKHGTGgNWIALPQKAGLRRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding34.54.8e-1169111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+ Ed ++    +  G++ W+ Ia+ ++ gRt++++k++w++
  PH01001541G0130  69 GEFTEHEDRIICGMYASIGSR-WSIIASQLP-GRTDNDIKNYWNT 111
                      78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.884966IPR017930Myb domain
SuperFamilySSF466891.3E-2711109IPR009057Homeodomain-like
SMARTSM007179.4E-131364IPR001005SANT/Myb domain
PfamPF002498.3E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-241569IPR009057Homeodomain-like
CDDcd001673.83E-101662No hitNo description
SMARTSM007171.9E-1067115IPR001005SANT/Myb domain
PROSITE profilePS5129415.37667117IPR017930Myb domain
PfamPF002493.8E-969111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2270117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGRAPCCDKN NVKKGPWSPE EDAKLKEFIE KHGTGGNWIA LPQKAGLRRC GKSCRLRWLN  60
YLRPNIKHGE FTEHEDRIIC GMYASIGSRW SIIASQLPGR TDNDIKNYWN TKLKKKLLVS  120
TAGAPLPRPP RQHHRPVLLP HSSSLPHPSY NGFFTGAGSI QEPFIPTLTL PTTQDYMLSS  180
GSLTMTNASA LLHAQGAAHQ LQVEETSSMI VFGTDQPSCS SSDGTHNQFG YHGKELSFDG  240
YSYGYNGIIE QDHKLFQQEQ AQLDYNYEEI KQLLMTTSAA GLHDQEAMEG LIGSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26141177108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001541G0130
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0962050.0FP096205.1 Phyllostachys edulis cDNA clone: bphylf043l07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975125.11e-140transcription factor RAX2
TrEMBLA0A3L6PSV41e-145A0A3L6PSV4_PANMI; Transcription factor RAX2-like
STRINGSi010627m1e-139(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-75myb domain protein 36