PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01001304G0330 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | GRF | ||||||||
Protein Properties | Length: 170aa MW: 18478 Da PI: 9.7106 | ||||||||
Description | GRF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRC | 76.3 | 3.1e-24 | 81 | 125 | 1 | 45 |
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 ++epgrCrRtDGKkWRC+r++++++k+CErH+hrgr+r + ++e PH01001304G0330 81 EPEPGRCRRTDGKKWRCWRNAIPNEKYCERHMHRGRKRPVQLVVE 125 69************************************9998875 PP | |||||||
2 | QLQ | 55.3 | 2e-19 | 15 | 50 | 2 | 37 |
QLQ 2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 aFTa+Qlq+L++Q +y+y+aa++PvP +L+++i+k PH01001304G0330 15 AFTAMQLQELEQQSRVYQYMAARVPVPTHLVFPIWK 50 8**********************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00951 | 4.7E-8 | 14 | 50 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51666 | 20.922 | 15 | 50 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
Pfam | PF08880 | 3.1E-12 | 15 | 49 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51667 | 22.97 | 81 | 125 | IPR014977 | WRC domain |
Pfam | PF08879 | 3.1E-20 | 82 | 120 | IPR014977 | WRC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005524 | Molecular Function | ATP binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MKALVASVPA DAGAAFTAMQ LQELEQQSRV YQYMAARVPV PTHLVFPIWK SVTGASSEGA 60 QKYPTLMGLA TLCLDFGKNP EPEPGRCRRT DGKKWRCWRN AIPNEKYCER HMHRGRKRPV 120 QLVVEDDEPD SASGSKSASG KATEGGKKTD DKSSSSKKLA VAAPAAVEST |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01001304G0330 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP099168 | 0.0 | FP099168.1 Phyllostachys edulis cDNA clone: bphylf034g02, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006657676.1 | 1e-120 | PREDICTED: growth-regulating factor 11 | ||||
Swissprot | Q6AWX8 | 1e-120 | GRF11_ORYSJ; Growth-regulating factor 11 | ||||
TrEMBL | A0A0E0LKD2 | 1e-119 | A0A0E0LKD2_ORYPU; Uncharacterized protein | ||||
STRING | OPUNC07G12320.1 | 1e-120 | (Oryza punctata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6735 | 31 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13960.1 | 2e-31 | growth-regulating factor 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|