PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001287G0090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 253aa    MW: 28133.7 Da    PI: 7.2869
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001287G0090genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.3e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ lv  ++++G  +W++ ++  g+ R++k+c++rw +yl
  PH01001287G0090 14 KGPWTPEEDKVLVAHIERFGHSNWRALPKLAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.74.7e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  PH01001287G0090  67 RGNFTKEEEDTIIQLHELLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129414.868961IPR017930Myb domain
SuperFamilySSF466895.14E-3110108IPR009057Homeodomain-like
SMARTSM007172.1E-121363IPR001005SANT/Myb domain
PfamPF002494.2E-141461IPR001005SANT/Myb domain
CDDcd001674.19E-101661No hitNo description
PROSITE profilePS5129425.98362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-2765116IPR009057Homeodomain-like
SMARTSM007172.0E-1566114IPR001005SANT/Myb domain
PfamPF002494.3E-1667112IPR001005SANT/Myb domain
CDDcd001671.40E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MGRAPCCEKM GLKKGPWTPE EDKVLVAHIE RFGHSNWRAL PKLAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TKEEEDTIIQ LHELLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLEPKA  120
QEHGAASAKK HKPAAPKRES GGRRTDVPTT APVSPERSVL SSVTESSMAS SVAEHGNTGS  180
SAFAKEESFT SGSEDFQIDE SFWSETLSMP LDSHDVSMEP RDAFGASSGA ADDMDFWLRV  240
FIEAGDVQQL PQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001287G0090
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0939540.0FP093954.1 Phyllostachys edulis cDNA clone: bphyem107b06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448188.11e-123transcription factor MYB4
SwissprotQ7XBH41e-120MYB4_ORYSJ; Transcription factor MYB4
TrEMBLA0A1D8F0K40.0A0A1D8F0K4_9POAL; MYB protein
STRINGSb06g022660.11e-122(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.12e-76myb domain protein 15
Publications ? help Back to Top
  1. Park MR, et al.
    Supra-optimal expression of the cold-regulated OsMyb4 transcription factor in transgenic rice changes the complexity of transcriptional network with major effects on stress tolerance and panicle development.
    Plant Cell Environ., 2010. 33(12): p. 2209-30
    [PMID:20807373]
  2. Solt├ęsz A, et al.
    The rice Osmyb4 gene enhances tolerance to frost and improves germination under unfavourable conditions in transgenic barley plants.
    J. Appl. Genet., 2012. 53(2): p. 133-43
    [PMID:22246661]