PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01001236G0110 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 162aa MW: 17519.5 Da PI: 6.5101 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 173.8 | 1.7e-54 | 23 | 118 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+ yv+p++ yl+kyreleg PH01001236G0110 23 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFGALGFDGYVDPMRRYLHKYRELEG 116 89******************************************************************************************** PP NF-YB 96 ek 97 ++ PH01001236G0110 117 DR 118 97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.7E-50 | 19 | 124 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.02E-38 | 25 | 124 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.3E-27 | 28 | 91 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.0E-17 | 56 | 74 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 59 | 75 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.0E-17 | 75 | 93 | No hit | No description |
PRINTS | PR00615 | 4.0E-17 | 94 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MADHHNQLGG SPDMAAAAGE EIKEQDRLLP IANVGRIMKQ ILPPNAKISK EAKETMQECV 60 SEFISFVTGE ASDKCHKEKR KTVNGDDVCW AFGALGFDGY VDPMRRYLHK YRELEGDRAA 120 AAASSRGGPD HPSTSGAGAS GTGHFMFNAM ERSDNNSSRQ F* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-43 | 22 | 113 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-43 | 22 | 113 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01001236G0110 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK242118 | 1e-138 | AK242118.1 Oryza sativa Japonica Group cDNA, clone: J075146M01, full insert sequence. | |||
GenBank | HG670306 | 1e-138 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015635864.1 | 3e-80 | nuclear transcription factor Y subunit B-1 | ||||
Refseq | XP_015635872.1 | 3e-80 | nuclear transcription factor Y subunit B-1 | ||||
Swissprot | Q75IZ7 | 3e-56 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A2WYT1 | 9e-80 | A2WYT1_ORYSI; Uncharacterized protein | ||||
STRING | ORUFI01G46550.1 | 1e-79 | (Oryza rufipogon) | ||||
STRING | OS01T0935200-01 | 1e-79 | (Oryza sativa) | ||||
STRING | ORGLA01G0368700.1 | 1e-79 | (Oryza glaberrima) | ||||
STRING | OBART01G43130.1 | 1e-79 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 3e-57 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|