PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001229G0260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 339aa    MW: 36046.1 Da    PI: 8.5502
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001229G0260genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+++v ++G+g +W + +++ g++R++k+c++rw++yl
  PH01001229G0260 14 KGPWSPEEDRKLKEYVDKYGTGgNWIALPHKAGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.13.5e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++ +Ed ++ ++++  G++ W+ Ia+ ++ gRt++++k++w++
  PH01001229G0260  69 GDFSDDEDRIICNLFASIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      679******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.755962IPR017930Myb domain
SuperFamilySSF466892.97E-2711109IPR009057Homeodomain-like
SMARTSM007174.6E-131364IPR001005SANT/Myb domain
PfamPF002497.8E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-241569IPR009057Homeodomain-like
CDDcd001673.67E-101662No hitNo description
PROSITE profilePS5129422.16663117IPR017930Myb domain
SMARTSM007172.1E-1167115IPR001005SANT/Myb domain
PfamPF002498.3E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2270117IPR009057Homeodomain-like
CDDcd001672.77E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGRAPCCDKA SVKKGPWSPE EDRKLKEYVD KYGTGGNWIA LPHKAGLKRC GKSCRLRWLN  60
YLRPNIKHGD FSDDEDRIIC NLFASIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMGL  120
PPTQRSKPVN HHKQQQLFFT AAAATAPILG DASTTTGAAA AAAHDHPFSL QHLAAPHQYS  180
SSSSSYSSSH CSSLQTASGG LMFGGDQQQM ITSSSCSDNG SLYFELCSGN SAGASASVGL  240
ESIFGGFDSM QNNLFPAHNT SGANLLDHQM YISRSSSDNN NAAPSWYEHE MKPFWVVPSG  300
STGLGLAAGG ATSSLFYGEA GAATSGAAAG ASQGRFLY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141177108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001229G0260
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956269.18e-91myb-related protein Hv1
TrEMBLA0A2S3GXU51e-92A0A2S3GXU5_9POAL; Uncharacterized protein
STRINGSi030544m3e-90(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.13e-76myb domain protein 36