PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001084G0440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 348aa    MW: 36783.6 Da    PI: 9.5972
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001084G0440genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-182065147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ l ++v+++G ++W++I++ ++ gR++k+c++rw + 
  PH01001084G0440 20 KGPWSPEEDDALQRLVARHGARNWSLISKSIP-GRSGKSCRLRWCNQ 65
                     79******************************.***********985 PP

2Myb_DNA-binding53.65.3e-1774116347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
  PH01001084G0440  74 PFTPEEDDTILRAHARFGNK-WATIARLLS-GRTDNAIKNHWNST 116
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.2741570IPR017930Myb domain
SuperFamilySSF466896.74E-3217113IPR009057Homeodomain-like
SMARTSM007171.6E-161968IPR001005SANT/Myb domain
PfamPF002491.9E-182065IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-262173IPR009057Homeodomain-like
CDDcd001679.65E-162264No hitNo description
SMARTSM007171.7E-1471119IPR001005SANT/Myb domain
PROSITE profilePS5129420.33872121IPR017930Myb domain
PfamPF002491.8E-1474116IPR001005SANT/Myb domain
CDDcd001671.28E-1174117No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2374120IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MAAAACRGGG GSAKDVDRIK GPWSPEEDDA LQRLVARHGA RNWSLISKSI PGRSGKSCRL  60
RWCNQLSPQV EHRPFTPEED DTILRAHARF GNKWATIARL LSGRTDNAIK NHWNSTLKRK  120
YSSAPNSMAH GLDAAAADDE ADMARPLKRT SSDGHPGLCF SPGSPSGSDL SDSSHHSLPS  180
VMPSSAAAAA AAAAAAATSQ PHPQQQQHVY RPVARTGGVV VLPTPPPPPA TSLSLSLSLP  240
GLDQPDPSPS EAAPAAPPPP LPVQPAPASQ MPPPRPMPFQ LQTPSQPAIN LAPARPPAPF  300
STEFLAMMQE MIRIEVRNYM SGFDPRSPAD GVHAAAAAKR MMGMAKIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-39171204107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00632PBMTransfer from PK28565.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001084G0440
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0928080.0FP092808.1 Phyllostachys edulis cDNA clone: bphyem205d01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020146152.11e-140transcription factor MYB44-like
TrEMBLA0A3B6LKC51e-141A0A3B6LKC5_WHEAT; Uncharacterized protein
STRINGTraes_5BL_486D0D865.11e-142(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-67myb domain protein 73