PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01001056G0170 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 165aa MW: 18212.4 Da PI: 9.8983 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 32.6 | 1.7e-10 | 7 | 65 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 kr +r NR +A rs +RK +i+eLe+kv+ L++e ++L +l l+ +a l +++ PH01001056G0170 7 KRVKRVLANRQSAARSKERKMRYIAELEQKVQILQTEATRLSTQLALLQRDSAGLATQN 65 999*********************************************99998887766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 9.6E-17 | 3 | 67 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.875 | 5 | 68 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 2.6E-11 | 7 | 64 | No hit | No description |
Pfam | PF00170 | 1.4E-9 | 7 | 65 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 2.89E-11 | 7 | 58 | No hit | No description |
CDD | cd14703 | 4.59E-18 | 8 | 59 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MVLADPKRVK RVLANRQSAA RSKERKMRYI AELEQKVQIL QTEATRLSTQ LALLQRDSAG 60 LATQNNELKF RLQAMEQQAQ LRDALNEALT TEVQHLKIAT AELGNSCSSN GLSSADPTQR 120 SESDASIAAA GYNDTVLSTA TDSRTAQRRT MNQKNDYRDI WTGS* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:11390974, ECO:0000269|PubMed:12855676, ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01001056G0170 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006649313.1 | 1e-64 | PREDICTED: transcription factor RF2a-like | ||||
Refseq | XP_025796879.1 | 1e-62 | transcription factor RF2b-like | ||||
Swissprot | Q69IL4 | 5e-44 | RF2A_ORYSJ; Transcription factor RF2a | ||||
TrEMBL | J3LJI7 | 2e-63 | J3LJI7_ORYBR; Uncharacterized protein | ||||
STRING | Pavir.J19159.1.p | 8e-64 | (Panicum virgatum) | ||||
STRING | OB03G12130.1 | 4e-64 | (Oryza brachyantha) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3536 | 35 | 76 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G21230.1 | 6e-46 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|