PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001023G0060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 295aa    MW: 30628.8 Da    PI: 5.2174
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001023G0060genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.81e-071661245
                     SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     g WT e ++ + +a +    +    W++Ia+ +  g+t+++++ ++ 
  PH01001023G0060 16 GGWTREQEKAFENALATTEEEgdaVWEKIAEVVE-GKTAEEVRQHYE 61
                     67****************999*************.**********95 PP

2Myb_DNA-binding39.81e-12121165347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
  PH01001023G0060 121 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVISRTPTQVASHAQKY 165
                      6*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.9791368IPR017884SANT domain
SMARTSM007171.0E-51466IPR001005SANT/Myb domain
PfamPF002496.7E-61661IPR001005SANT/Myb domain
SuperFamilySSF466891.22E-91770IPR009057Homeodomain-like
CDDcd001671.13E-71864No hitNo description
Gene3DG3DSA:1.10.10.609.0E-41864IPR009057Homeodomain-like
PROSITE profilePS5129417.44114170IPR017930Myb domain
SuperFamilySSF466892.87E-16116171IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-17118168IPR006447Myb domain, plants
SMARTSM007179.3E-11118168IPR001005SANT/Myb domain
CDDcd001673.01E-10121166No hitNo description
PfamPF002493.3E-11121165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-11121164IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MAVEEASSSS GEEGSGGWTR EQEKAFENAL ATTEEEGDAV WEKIAEVVEG KTAEEVRQHY  60
ELLVEDVDGI ESGRVPLPVY AGDGDAEEGS GGGGKKGGGG GGHGEKGSAK SAEQERRKGI  120
AWTEDEHRLF LLGLEKYGKG DWRSISRNFV ISRTPTQVAS HAQKYFIRLT SMNRERRRSS  180
IHDITSVNNG DASAAQGPIT GQTNGQAANP GKSPKQSAQP ANTPPGVDAF GTTIGQPVGG  240
PLVSAVGTPV SLPVPAAPHM AYAIHAPVPG AVVPGAPINM PPIPYPMPPP SSHG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-151484677RADIALIS
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
192100GGKKGGGGG
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01001023G0060
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0939440.0FP093944.1 Phyllostachys edulis cDNA clone: bphylf060p06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448771.11e-154transcription factor SRM1
SwissprotQ9FNN61e-102SRM1_ARATH; Transcription factor SRM1
TrEMBLC5YAI21e-153C5YAI2_SORBI; Uncharacterized protein
STRINGSb06g032880.11e-154(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63763854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-87MYB family protein
Publications ? help Back to Top
  1. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  2. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]