PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000958G0180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 989aa    MW: 111211 Da    PI: 4.8641
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000958G0180genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.9e-14853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
  PH01000958G0180  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding32.81.6e-1060103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
  PH01000958G0180  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.8E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
PfamPF139214.6E-131070No hitNo description
CDDcd001675.00E-121053No hitNo description
SuperFamilySSF466896.47E-2133108IPR009057Homeodomain-like
CDDcd116598.69E-3155106No hitNo description
Gene3DG3DSA:1.10.10.603.4E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
PfamPF118318.0E-57406654IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 989 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACAKD ENYEPNDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDTRQR RRKRKGIDYN AEIPFEKRPP PGFYDTVGED RPLEHVQFPT  240
TIEELEGKRR VDIEAQLRKQ DIAKNKILQR QDAPAAIMQA NKLNDPEAVT KRSKLMLPPP  300
QISDHELEEI AKMGNAGDPT LAEELGEGST ATRTLLASYS QTPRLGMTPL RTPQRTPAGK  360
GDAIMMEAEN LARLRESQTP LLGGDNPELH PSDFSGVTPR KKEIQTPNPM LTPLASPGPG  420
VTPRIGMTPS RDGNSFVLTP KGTPFRDVLH INEDVEMQDS AQLELRRQAE LRKNLRSGFS  480
SIPQPKNEYQ IVMPPITEET EEVEEKIEED MSEKLARERA EEQTRQEALL RKRSKVLQRS  540
LPRPPAGSVE ILRQSLIKGG ESRSRSTFVP PTSLEQADEL INTELLRLLE HDNAKYPLDE  600
KTQKEKKKGN KRQENGAAFV PEIEDFDEDE LKEASSMVEE EIQYLRVAMG HENDFFEDFV  660
KAHDACQEDL MFFPTNNSYG LASVAGNADK VAAFQNEFEI VKKRMDDEAK KASRLEQKIK  720
LLTQGYQARA GKLWSQVQDT FKQMDTAATE LECFQELQKQ EQMAASYRVR NLTEEVNKQK  780
ALERTLQSCY GDLLSGYQRI QEQLEEHKRQ LKIQEAVEAE NRAREEEIAA QNRAAEEENE  840
RKNCSVEEEI GQMNGATDVE AAGSKEINGD QMDVDNRNED GEFVGPIPPA PDTQGDNNEA  900
SVQQNTSNAQ SGDNATPNDG ACDKIDSSNL GGQDNTDGGM AVNASMAVNA SSQEEGKNEL  960
ATVGTSMNEG NTDVSSNQDV SKEENGSP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5mqf_L0.027943792Cell division cycle 5-like protein
5xjc_L0.027943792Cell division cycle 5-like protein
5yzg_L0.027943792Cell division cycle 5-like protein
5z56_L0.027943792Cell division cycle 5-like protein
5z57_L0.027943792Cell division cycle 5-like protein
5z58_L0.027943792Cell division cycle 5-like protein
6ff4_L0.027943792Cell division cycle 5-like protein
6ff7_L0.027943792Cell division cycle 5-like protein
6icz_L0.027943792Cell division cycle 5-like protein
6id0_L0.027943792Cell division cycle 5-like protein
6id1_L0.027943792Cell division cycle 5-like protein
6qdv_O0.027943792Cell division cycle 5-like protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDTRQRRRKRK
Functional Description ? help Back to Top
Source Description
UniProtComponent of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000958G0180
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1022480.0AK102248.1 Oryza sativa Japonica Group cDNA clone:J033088F07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576174.10.0cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA0A287RYT10.0A0A287RYT1_HORVV; Uncharacterized protein
STRINGBRADI4G07110.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44163553
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Li S, et al.
    MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis.
    Plant Cell, 2018. 30(2): p. 481-494
    [PMID:29437988]