PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000912G0430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 248aa    MW: 27623 Da    PI: 5.9097
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000912G0430genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +lv  ++++G  +W++ ++  g+ R++k+c++rw +yl
  PH01000912G0430 14 RGPWTAEEDRILVAHIERHGHSNWRALPKQAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding49.11.3e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE++ +++++ +lG++ W+ Ia++++ gRt++++k+ w+++l
  PH01000912G0430  67 RGNFTREEEDAIIHLHDLLGNR-WSEIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.051961IPR017930Myb domain
SuperFamilySSF466892.75E-3010108IPR009057Homeodomain-like
SMARTSM007171.4E-131363IPR001005SANT/Myb domain
PfamPF002499.7E-151461IPR001005SANT/Myb domain
CDDcd001671.85E-111661No hitNo description
PROSITE profilePS5129426.24662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-2665116IPR009057Homeodomain-like
SMARTSM007174.9E-1466114IPR001005SANT/Myb domain
PfamPF002492.6E-1467112IPR001005SANT/Myb domain
CDDcd001676.98E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGRAPCCEKM GLKRGPWTAE EDRILVAHIE RHGHSNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TREEEDAIIH LHDLLGNRWS EIAARLPGRT DNEIKNVWHT HLKKRLEPKP  120
SGQAQGTISA PKRKAKKPEA MSALDDPTTV PVLPEQSLST SATTDYSMAS SFENADSFTS  180
EEDFQIDDSF WSETLAITVD SSGSGMESGD VPFGTDCASP PSSSNDDMDF WLRLFMQAGD  240
MQCLSQI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26121175109B-MYB
1h8a_C2e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtActs as negative regulator of cold tolerance. Negatively regulates beta-amylase genes at the transcriptional level in response to cold stress. Suppresses beta-amylase gene expression by interacting with TIFY11A/JAZ9. Maltose produced by beta-amylases has a role in protecting cell membranes under cold stress conditions in rice and may contribute to the cold tolerance as a compatible solute. {ECO:0000269|PubMed:28062835}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000912G0430
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by cold stress and flooding. {ECO:0000269|PubMed:28062835}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1120561e-142AK112056.1 Oryza sativa Japonica Group cDNA clone:001-110-C03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575391.11e-134transcription factor MYB30
SwissprotQ6K1S61e-123MYB30_ORYSJ; Transcription factor MYB30
TrEMBLA0A3B6PM531e-133A0A3B6PM53_WHEAT; Uncharacterized protein
TrEMBLA0A446WER01e-133A0A446WER0_TRITD; Uncharacterized protein
STRINGTraes_6DL_991931CF9.21e-134(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.13e-82myb domain protein 14
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Yilmaz A, et al.
    GRASSIUS: a platform for comparative regulatory genomics across the grasses.
    Plant Physiol., 2009. 149(1): p. 171-80
    [PMID:18987217]
  3. Lv Y, et al.
    The OsMYB30 Transcription Factor Suppresses Cold Tolerance by Interacting with a JAZ Protein and Suppressing β-Amylase Expression.
    Plant Physiol., 2017. 173(2): p. 1475-1491
    [PMID:28062835]