PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000847G0490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 276aa    MW: 30661.6 Da    PI: 5.366
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000847G0490genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.6e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv    +    +W+++++  g+ R++k+c++rw +yl
  PH01000847G0490 14 KGPWTAEEDQKLVSFLLRNSQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding55.61.3e-1770111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +++E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
  PH01000847G0490  70 LSEDEEKTVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      589****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-19563IPR009057Homeodomain-like
PROSITE profilePS5129411.781961IPR017930Myb domain
SuperFamilySSF466896.13E-2611108IPR009057Homeodomain-like
SMARTSM007172.2E-101363IPR001005SANT/Myb domain
PfamPF002499.6E-131461IPR001005SANT/Myb domain
PROSITE profilePS5129426.96362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-2564117IPR009057Homeodomain-like
SMARTSM007171.1E-1566114IPR001005SANT/Myb domain
PfamPF002491.6E-1570111IPR001005SANT/Myb domain
CDDcd001673.94E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLVSFLL RNSQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEDEEKTVID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPVTHKPLQ PAPPPQQPQH LAGGDSPEHK VPEEENVVLA TGSQLSGGHD VFCTDEVPMM  180
QLDDVILPYD VAVPNISSSS ATGSPESSSS SSSASASSSG GFEDEWLPPI MEWPESMYLM  240
GLDDIVTGLT SWDEFEDPFN TYQRIALFDH QETWA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28121165108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as positive regulator of abscisic acid (ABA) signaling in response to salt stress. Acts as negative regulator ABI1, ABI2 and PP2CA, which are protein phosphatases 2C acting as negative regulator of ABA signaling. Binds to the DNA specific sequence and core element 5'-ACGT-3' found in the promoters of ABI1 and PP2CA to negatively regulate their expression during ABA-dependent salt stress response. {ECO:0000269|PubMed:23660402}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000847G0490
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress, drought stress and abscisic acid (ABA). Down-regulated by salicylic acid (SA) methyl jasmonate (JA). {ECO:0000269|PubMed:23660402}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU3908810.0GU390881.1 Fargesia fungosa MYB1 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020186333.11e-138protein ODORANT1-like
SwissprotQ9C7U78e-85MYB20_ARATH; Transcription factor MYB20
TrEMBLA0A0F6MY171e-163A0A0F6MY17_9POAL; Myb R2R3
STRINGEMT200291e-137(Aegilops tauschii)
STRINGTraes_5DL_46D39C394.11e-137(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.15e-84myb domain protein 20
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]