PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000688G0030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 190aa    MW: 21055.4 Da    PI: 9.8138
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000688G0030genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.62.5e-073074345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     +W++ Ed+ +  a   ++ +   +W+ +a++++ gRt+ +  +++q
  PH01000688G0030 30 PWSKAEDKVFESALVTFPENvqnRWAHVAARLP-GRTAQEAWEHYQ 74
                     8********************************.****98777777 PP

2Myb_DNA-binding46.21e-14121165347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++++ +++G g+W+ I+r   k+Rt+ q+ s+ qky
  PH01000688G0030 121 PWTEEEHRLFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKY 165
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.0892381IPR017930Myb domain
SuperFamilySSF466895.25E-112477IPR009057Homeodomain-like
SMARTSM007179.3E-52779IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-73073IPR009057Homeodomain-like
CDDcd001673.28E-53068No hitNo description
PfamPF002491.1E-53074IPR001005SANT/Myb domain
PROSITE profilePS5129420.291114170IPR017930Myb domain
SuperFamilySSF466891.79E-18116171IPR009057Homeodomain-like
SMARTSM007179.2E-11118168IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.7E-17118169IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.6E-11120164IPR009057Homeodomain-like
CDDcd001672.28E-11121166No hitNo description
PfamPF002491.3E-11121165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MAFYRGVGGP SSSWVAAPQA MMAPPPSSRP WSKAEDKVFE SALVTFPENV QNRWAHVAAR  60
LPGRTAQEAW EHYQALVADV DLIERGMVEA PDSWDDDAAS GGRGRGRLGG GGADERRRGV  120
PWTEEEHRLF LEGLEKYGRG DWRNISRWSV KTRTPTQVAS HAQKYFIRQA NATSRGDNKR  180
KSIHDITAP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-132792772RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000688G0030
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3679541e-149AK367954.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2065H11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638220.17e-99transcription factor DIVARICATA
SwissprotQ8S9H72e-48DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLI1PW292e-98I1PW29_ORYGL; Uncharacterized protein
STRINGORGLA05G0157700.14e-99(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.15e-43MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]