PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000604G0860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 237aa    MW: 26573.9 Da    PI: 8.0726
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000604G0860genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-152168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed +lv  v++lG ++W+  a+  g++Rt+k+c++rw +yl
  PH01000604G0860 21 KGPWTEQEDARLVWFVRLLGERRWDFLAKVSGLNRTGKSCRLRWVNYL 68
                     79********************************************97 PP

2Myb_DNA-binding35.62.2e-1174115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr+T++E+ l v++++    + W++Ia+ ++ gRt++++k++w++++
  PH01000604G0860  74 RGRMTPDEERLVVELHA----K-WSRIAKGVP-GRTDNEIKNYWRTHM 115
                      89********9999997....5.999******.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.1491672IPR017930Myb domain
SuperFamilySSF466897.52E-2419111IPR009057Homeodomain-like
SMARTSM007171.1E-122070IPR001005SANT/Myb domain
PfamPF002497.3E-142168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-192275IPR009057Homeodomain-like
CDDcd001671.08E-82368No hitNo description
SMARTSM007178.3E-973117IPR001005SANT/Myb domain
PROSITE profilePS5129415.62273119IPR017930Myb domain
PfamPF002491.6E-974114IPR001005SANT/Myb domain
CDDcd001677.97E-976115No hitNo description
Gene3DG3DSA:1.10.10.608.2E-1976118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MVAAAKSKAK TAATKGVEVR KGPWTEQEDA RLVWFVRLLG ERRWDFLAKV SGLNRTGKSC  60
RLRWVNYLHP GLKRGRMTPD EERLVVELHA KWSRIAKGVP GRTDNEIKNY WRTHMRKKKA  120
QQEKATRAGS TTTSMSMSAS PASSSSSNIN QAHEAVLRGN CEDEEEAATA ASQELYTSMH  180
MDLQLWNVID PGSYVDSWSS GAAVSMPSPV WEYCSDSLWG IDDEEEEEYK KMLDAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-23181181104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000604G0860
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519392e-68JF951939.2 Triticum aestivum clone TaMYB56 MYB-related protein mRNA, complete cds.
GenBankJN1913462e-68JN191346.1 Triticum aestivum MYB13-2 mRNA, complete cds.
GenBankJN1913472e-68JN191347.1 Triticum aestivum MYB13-3 mRNA, complete cds.
GenBankJX1836172e-68JX183617.1 Triticum aestivum MYB protein (MYB56) mRNA, MYB56-B allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020085908.12e-71transcription factor MYB59-like
SwissprotQ4JL761e-63MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLA0A0D3G2I92e-72A0A0D3G2I9_9ORYZ; Uncharacterized protein
STRINGOBART05G01080.14e-73(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.37e-60myb domain protein 59
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]