PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000520G0240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 261aa    MW: 28279.1 Da    PI: 7.8076
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000520G0240genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.21.1e-14351148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd l+++ ++++G g +W + ++t+g+ R++ +c+srw++yl
  PH01000520G0240  3 KGKWSKEEDNLIKNHIEKYGIGrSWQALSNTLGLQRCGRSCRSRWLNYL 51
                     79******************999************************97 PP

2Myb_DNA-binding33.78.6e-1158101247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g++T+ E++++ +   + G+  W+ Ia  ++ gRt+  +k++w++ 
  PH01000520G0240  58 GNFTPAEEKIICEMYSKRGSC-WSIIATQLP-GRTDLAIKNYWNST 101
                      89*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.954155IPR017930Myb domain
SuperFamilySSF466891.41E-25298IPR009057Homeodomain-like
SMARTSM007176.2E-10253IPR001005SANT/Myb domain
PfamPF002492.8E-12351IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-20458IPR009057Homeodomain-like
CDDcd001671.18E-9551No hitNo description
SMARTSM007178.8E-1056104IPR001005SANT/Myb domain
PROSITE profilePS5129415.28256106IPR017930Myb domain
PfamPF002491.5E-958101IPR001005SANT/Myb domain
CDDcd001672.77E-759102No hitNo description
Gene3DG3DSA:1.10.10.609.1E-2159105IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MKKGKWSKEE DNLIKNHIEK YGIGRSWQAL SNTLGLQRCG RSCRSRWLNY LRPGLKHGNF  60
TPAEEKIICE MYSKRGSCWS IIATQLPGRT DLAIKNYWNS TLKKRFPAAR GTAARRRHRP  120
AASTSSDAAT PDLALVVYSE ESTTTGSSSH DGADKPVLTG SPSVQVQVQP PPAGAGGNAP  180
NEEPIAAVPI SGPVRIEQKP ALGSLTLEKT PPPPPPGEQT GEMDIACAPM SPIPLAFMEP  240
ELACIIDFDD IDSFLPWFDD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-23110625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000520G0240
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126188e-31CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661280.11e-120transcription factor RAX2
TrEMBLA0A368SIM71e-118A0A368SIM7_SETIT; Uncharacterized protein
STRINGSi037244m1e-104(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122282638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.11e-42myb domain protein 87