PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000515G0560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 277aa    MW: 31172 Da    PI: 5.6826
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000515G0560genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.9e-183279148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT +Ed+ l+++++++G g+W+t ar  g++Rt+k+c++rw++yl
  PH01000515G0560 32 RGPWTVDEDLTLINYIAEHGEGRWNTLARAAGLKRTGKSCRLRWLNYL 79
                     89********************************************97 PP

2Myb_DNA-binding57.53.2e-1885128146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  PH01000515G0560  85 RGNFTAEEQLLILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 128
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0352779IPR017930Myb domain
SuperFamilySSF466894.97E-3130126IPR009057Homeodomain-like
SMARTSM007173.7E-153181IPR001005SANT/Myb domain
PfamPF002491.5E-163279IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-233386IPR009057Homeodomain-like
CDDcd001671.44E-103479No hitNo description
PROSITE profilePS5129424.45180134IPR017930Myb domain
SMARTSM007173.3E-1684132IPR001005SANT/Myb domain
PfamPF002491.3E-1685128IPR001005SANT/Myb domain
CDDcd001671.88E-1187128No hitNo description
Gene3DG3DSA:1.10.10.606.3E-2587133IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MVLQRSNGMA CRPGPTTLPP AQEQEAEAEL RRGPWTVDED LTLINYIAEH GEGRWNTLAR  60
AAGLKRTGKS CRLRWLNYLR PDVKRGNFTA EEQLLILDLH SRWGNRWSKI AQHLPGRTDN  120
EIKNYWRTRV QKHAKQLSCD VNSQRFKDAM KYLWMPRLVE RIQASAAAAA AGNDASCVSG  180
VTMATAGCLE NSPGMVTSSS SCSFTSESLE EKSLHVLGGE ETNCGEWMQE ADHEFWSMAI  240
QPNDQLQDQE LNGWVQGFSE GISENLWSLD DIWKMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-262913224126MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in the jasmonate-dependent defense responses to the rice blast fungus Magnaporthe oryzae. Does not seem to function in the salicylic acid-dependent signaling pathway. {ECO:0000269|PubMed:11310740}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000515G0560
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA), wounding and infection by the fungal pathogen Magnaporthe oryzae. {ECO:0000269|PubMed:11310740}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0090181e-135BT009018.1 Triticum aestivum clone wdk3c.pk006.n12:fis, full insert mRNA sequence.
GenBankKJ7284141e-135KJ728414.1 Zea mays clone pUT6719 MYB transcription factor (MYB4) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663109.11e-138PREDICTED: transcription factor MYB108-like
RefseqXP_015618000.11e-138transcription factor JAMYB
SwissprotQ2QZJ81e-139JAMYB_ORYSJ; Transcription factor JAMYB
TrEMBLA0A0E0RC241e-136A0A0E0RC24_ORYRU; Uncharacterized protein
TrEMBLJ3NA961e-136J3NA96_ORYBR; Uncharacterized protein
STRINGORUFI11G24630.11e-137(Oryza rufipogon)
STRINGOS11T0684000-011e-137(Oryza sativa)
STRINGOB11G27320.11e-137(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.14e-79myb domain protein 112
Publications ? help Back to Top
  1. Ahn IP,Kim S,Kang S,Suh SC,Lee YH
    Rice Defense Mechanisms Against Cochliobolus miyabeanus and Magnaporthe grisea Are Distinct.
    Phytopathology, 2005. 95(11): p. 1248-55
    [PMID:18943354]
  2. Campos-Soriano L,García-Martínez J,San Segundo B
    The arbuscular mycorrhizal symbiosis promotes the systemic induction of regulatory defence-related genes in rice leaves and confers resistance to pathogen infection.
    Mol. Plant Pathol., 2012. 13(6): p. 579-92
    [PMID:22212404]
  3. Yokotani N, et al.
    Role of the rice transcription factor JAmyb in abiotic stress response.
    J. Plant Res., 2013. 126(1): p. 131-9
    [PMID:22847900]
  4. Wang D, et al.
    Expression analysis of innate immunity related genes in the true/field blast resistance gene-mediated defence response.
    Biotechnol. Biotechnol. Equip., 2014. 28(6): p. 999-1007
    [PMID:26740780]
  5. Fred AK,Kiswara G,Yi G,Kim KM
    Screening Rice Cultivars for Resistance to Bacterial Leaf Blight.
    J. Microbiol. Biotechnol., 2016. 26(5): p. 938-45
    [PMID:26869604]