PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000508G0100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 334aa    MW: 36499.7 Da    PI: 6.3013
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000508G0100genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
  PH01000508G0100 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding55.71.1e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+T+eE++l++ +++  G++ W+ Ia++++ gRt++++k++w+++
  PH01000508G0100  67 RGRFTAEEEKLIISLHAIVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.264961IPR017930Myb domain
SuperFamilySSF466897.86E-3011108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.5E-151461IPR001005SANT/Myb domain
CDDcd001674.22E-121761No hitNo description
PROSITE profilePS5129425.93262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-2565116IPR009057Homeodomain-like
SMARTSM007172.1E-1766114IPR001005SANT/Myb domain
PfamPF002493.5E-1667111IPR001005SANT/Myb domain
CDDcd001671.69E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TAEEEKLIIS LHAIVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPA  120
NTTSSSATTS PSNPPPCSTA TSDVHAAHHL REVPTFSTTD HQLDAIINHS LTLPPKLAVG  180
CGGGQESPPG LPHHCPLFMF DTGVSPSSSL ITAAAAAQHP FIASFTAAMA DAPSYLPPLV  240
DGMGMGIGAM DSVGIQERGG GGHEGSDQAA ATGMAHACYE HQNQQEEEDQ LGHDEWDDEA  300
QHLLMWDQEL TPSNLDAIQS GAHSLLFMGP NDHD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27141167108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000508G0100
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0919260.0FP091926.1 Phyllostachys edulis cDNA clone: bphylf039g20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443851.11e-148transcription factor MYB41
TrEMBLA0A2T7D3G11e-156A0A2T7D3G1_9POAL; Uncharacterized protein
STRINGPavir.Fb00364.1.p1e-149(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60323757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.15e-84myb domain protein 103