PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000501G0490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 322aa    MW: 34627.1 Da    PI: 7.8702
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000501G0490genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++q+G g+W++ + + g++R++k+c++rw +yl
  PH01000501G0490 15 KGPWTPEEDQKLLAYIEQHGHGCWRSLPTKAGLRRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding54.33.2e-1768113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  PH01000501G0490  68 RGKFTLQEEKTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-25765IPR009057Homeodomain-like
PROSITE profilePS5129418.7411062IPR017930Myb domain
SuperFamilySSF466893.74E-3012109IPR009057Homeodomain-like
SMARTSM007172.5E-151464IPR001005SANT/Myb domain
PfamPF002491.1E-161562IPR001005SANT/Myb domain
CDDcd001678.94E-121762No hitNo description
PROSITE profilePS5129425.663117IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2666117IPR009057Homeodomain-like
SMARTSM007179.1E-1767115IPR001005SANT/Myb domain
PfamPF002491.8E-1668113IPR001005SANT/Myb domain
CDDcd001678.67E-1270113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRSPCCEKE AGLKKGPWTP EEDQKLLAYI EQHGHGCWRS LPTKAGLRRC GKSCRLRWTN  60
YLRPDIKRGK FTLQEEKTII QLHALLGNRW SAIATHLPKR TDNEIKNYWN THLKKRLAKM  120
GIDPVTHKPR ADADASDTAA ASSGVSGARS RAAAHLSHTA QWESARLEAE ARLAREAKLR  180
ALASPAPAAS GLESPTSTLS FSESVLFAGV PHVMHGAARA PVQPMQSYGE ACEEHHFGGG  240
AGPGFVGAGT FASVLLDCSV AGTDQRFAAS AEAGVGEHEA EEEDKGYWIS ILNMVNTSMS  300
SLTSEVVTDP VMFVPLAAAE F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27131175108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtFunctions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000501G0490
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794241e-175HF679424.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB18 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572652.11e-161transcription factor MYB106
SwissprotQ9LE631e-111MY106_ARATH; Transcription factor MYB106
TrEMBLA0A0D3F6V01e-168A0A0D3F6V0_9ORYZ; Uncharacterized protein
STRINGOBART02G21860.11e-169(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.23e-86myb domain protein 16