PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000445G0700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 311aa    MW: 34607.9 Da    PI: 5.8388
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000445G0700genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.71.8e-203582148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd llvd+++++G g+W++ ar+ g++Rt+k+c++rw++yl
  PH01000445G0700 35 RGPWTAEEDMLLVDYIAKHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 82
                     89********************************************97 PP

2Myb_DNA-binding52.71e-1688131146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  PH01000445G0700  88 RGNITPEEQLLILELHSRWGNR-WSKIAQRLP-GRTDNEIKNYWRT 131
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.9883082IPR017930Myb domain
SuperFamilySSF466892.16E-3233129IPR009057Homeodomain-like
SMARTSM007173.9E-173484IPR001005SANT/Myb domain
PfamPF002495.0E-183582IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-243689IPR009057Homeodomain-like
CDDcd001671.86E-143782No hitNo description
PROSITE profilePS5129423.29883137IPR017930Myb domain
SMARTSM007175.1E-1587135IPR001005SANT/Myb domain
PfamPF002491.3E-1588131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2390136IPR009057Homeodomain-like
CDDcd001672.40E-1292131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009620Biological Processresponse to fungus
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MEMEMEKMEM EMEMFGMSPT GLAATASEDE GDLRRGPWTA EEDMLLVDYI AKHGEGRWNS  60
LARCAGLKRT GKSCRLRWLN YLRPGVRRGN ITPEEQLLIL ELHSRWGNRW SKIAQRLPGR  120
TDNEIKNYWR TRVQKHAKQL KCDVNSKQFR DVVRYIWMPR LVERIQAGSA TAATGDVTAS  180
LPVTRTMSSP GAHLSAYQNA VPNKANHCMS SSEPNPPMVT MSPDTSSTLR SSSLTEGSHA  240
AHFTPVIEGA VVVQDGGESG SMGDDVIHSS DVFSGSWSEL LATTGLPDFE FGDPDDSLWS  300
LEDIFLQQHY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-263212924120MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00334DAPTransfer from AT3G06490Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000445G0700
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020164818.11e-130transcription factor MYB30-like
TrEMBLA0A3B5ZPI51e-128A0A3B5ZPI5_WHEAT; Uncharacterized protein
TrEMBLA0A452XWE91e-128A0A452XWE9_AEGTS; Uncharacterized protein
STRINGTraes_1AS_36AF74187.21e-126(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.11e-83myb domain protein 78