PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000427G0040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 262aa    MW: 28722.3 Da    PI: 7.4726
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000427G0040genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l+  +  +G  +W+++++  g+ R++k+c++rw +yl
  PH01000427G0040 14 RGPWTAEEDKKLISFILTHGRCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding56.56.2e-1869111347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        T++E++l vd++++lG++ W++Ia++++ gRt++++k++w+++
  PH01000427G0040  69 LLTADEEQLVVDLHAKLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 111
                      569*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-22563IPR009057Homeodomain-like
PROSITE profilePS5129414.138961IPR017930Myb domain
SuperFamilySSF466893.18E-2712108IPR009057Homeodomain-like
SMARTSM007174.2E-131363IPR001005SANT/Myb domain
PfamPF002492.9E-151461IPR001005SANT/Myb domain
CDDcd001679.18E-111661No hitNo description
PROSITE profilePS5129428.16262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2564117IPR009057Homeodomain-like
SMARTSM007179.6E-1666114IPR001005SANT/Myb domain
PfamPF002491.6E-1569111IPR001005SANT/Myb domain
CDDcd001674.58E-1371112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGRQPCCDKQ AVKRGPWTAE EDKKLISFIL THGRCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL TADEEQLVVD LHAKLGNRWS KIAAKLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPATHQPLA NTKAASPTGT TSQSTVTTES AKSSDTINRL DSKGGCSGGM SMPTDTSEQS  180
SRNTGGHDQG PFVNWLLEAE LPVDEPWLDF GSSNDDELSS MAGPLPWDGT TDWLLDYQDF  240
GMGDSSLIDS AMFHSSSGSK F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtR2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000427G0040
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1060391e-127AK106039.1 Oryza sativa Japonica Group cDNA clone:001-206-D11, full insert sequence.
GenBankAK1117401e-127AK111740.1 Oryza sativa Japonica Group cDNA clone:J023047I22, full insert sequence.
GenBankAK1210231e-127AK121023.1 Oryza sativa Japonica Group cDNA clone:J023049M10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006659660.11e-152PREDICTED: protein ODORANT1-like
SwissprotQ50EX66e-90ODO1_PETHY; Protein ODORANT1
TrEMBLJ3MV171e-151J3MV17_ORYBR; Uncharacterized protein
STRINGOB08G29480.11e-151(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.16e-83myb domain protein 85
Publications ? help Back to Top
  1. Verdonk JC,Haring MA,van Tunen AJ,Schuurink RC
    ODORANT1 regulates fragrance biosynthesis in petunia flowers.
    Plant Cell, 2005. 17(5): p. 1612-24
    [PMID:15805488]