PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000415G0090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 284aa    MW: 30772.2 Da    PI: 6.7803
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000415G0090genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.54.6e-111562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l d++ + G g+W++ ++  g+ R +k+c++r  +yl
  PH01000415G0090 15 KGLWSPEEDQKLRDYILRRGHGCWSALPAQAGLQRNGKSCRLRSINYL 62
                     678****************************************88886 PP

2Myb_DNA-binding52.79.5e-1769113248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g +++eE++  + +++ lG++ W++Ia++++ gRt++++k++w++yl
  PH01000415G0090  69 GMFSPEEEKTVISLHAALGNK-WSRIASHLP-GRTDNEVKNYWNSYL 113
                      569******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.6151062IPR017930Myb domain
SuperFamilySSF466891.54E-2512109IPR009057Homeodomain-like
SMARTSM007175.9E-51464IPR001005SANT/Myb domain
PfamPF002493.0E-91562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-171669IPR009057Homeodomain-like
PROSITE profilePS5129424.12763117IPR017930Myb domain
SMARTSM007171.4E-1467115IPR001005SANT/Myb domain
PfamPF002496.2E-1669113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-2570117IPR009057Homeodomain-like
CDDcd001671.78E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MGCKACEKPR PNYRKGLWSP EEDQKLRDYI LRRGHGCWSA LPAQAGLQRN GKSCRLRSIN  60
YLRPGLKHGM FSPEEEKTVI SLHAALGNKW SRIASHLPGR TDNEVKNYWN SYLKKRVESS  120
KQGPNTPAPA TNSAADSDDS QSPKPGKTAQ EPASRPSNSD SSELPHESSS ADSSCLTATE  180
LPTFRAHAPV IPKVMFADWL NIAAAPGLEA AGVVGAGASP GDHHQVMSQG SVQIDGPSSV  240
DDSLHGFGDN GTCWEFPVQF DSIDQMQAGG FCDLLYMSEF FGLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23111193110B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000415G0090
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0968490.0FP096849.1 Phyllostachys edulis cDNA clone: bphyem207b10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953256.11e-143transcription factor MYB4
TrEMBLK3YUK11e-142K3YUK1_SETIT; Uncharacterized protein
STRINGSi017947m1e-143(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.17e-56myb domain protein 19