PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000400G0300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 314aa    MW: 34400.5 Da    PI: 6.65
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000400G0300genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.21.6e-073781244
                     SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     g+WT eE + + +a ++   +   +W+++a+ ++ g+t  ++  ++
  PH01000400G0300 37 GAWTLEENKVFEEALARVDRDapdRWERVAAFLP-GKTVADVMTHY 81
                     79*****************99*************.********998 PP

2Myb_DNA-binding45.71.5e-14151195347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G g+W+ I+r + + Rt+ q+ s+ qky
  PH01000400G0300 151 PWTEEEHKLFLMGLKKYGRGDWRNISRNFVTSRTPTQVASHAQKY 195
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.3423185IPR017877Myb-like domain
SMARTSM007174.9E-63587IPR001005SANT/Myb domain
SuperFamilySSF466894.67E-103792IPR009057Homeodomain-like
PfamPF002491.0E-53781IPR001005SANT/Myb domain
CDDcd001679.68E-63881No hitNo description
PROSITE profilePS5129417.568144200IPR017930Myb domain
SuperFamilySSF466891.42E-17146200IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-17147198IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.1E-12148194IPR009057Homeodomain-like
SMARTSM007175.8E-13148198IPR001005SANT/Myb domain
CDDcd001672.10E-11151196No hitNo description
PfamPF002497.3E-12151195IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MMKESYMEVL PLPPAPYFAG QAGGWFLQDW RDGVGGGAWT LEENKVFEEA LARVDRDAPD  60
RWERVAAFLP GKTVADVMTH YGDLENDVCF IEAGLVPFPH YSGGGSPSSG FTLDWDGGDD  120
AADLAAFKRS CYMVGGKRGR APDQERKKGV PWTEEEHKLF LMGLKKYGRG DWRNISRNFV  180
TSRTPTQVAS HAQKYFIRLN SGGKDKRRSS IHDITTVNLP DDDHSNPSPS PPSVLTANST  240
PSSAAAPVIS EQFGVLVDSK PPSPLGRSGH HHFIPHPYGN VKLEASNPHA AGYHGGRLDD  300
SVLMQMQCQL QPLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1436105877RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000400G0300
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0947400.0FP094740.1 Phyllostachys edulis cDNA clone: bphylf046m24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654489.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H77e-83DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLJ3M7R00.0J3M7R0_ORYBR; Uncharacterized protein
STRINGOB05G26340.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.16e-77MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]