PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000392G0510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 340aa    MW: 36821.2 Da    PI: 5.7052
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000392G0510genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.66.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT eEde+l++++k++G g+W++ ++  g+ R++k+c++rw +yl
  PH01000392G0510 14 KGRWTREEDEILAKYIKEHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding54.33e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ ++eE+e ++++++ lG++ W++Ia +++ gRt++++k++w+++l
  PH01000392G0510  67 RGNISEEEEEMIIKLHATLGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 112
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.758961IPR017930Myb domain
SuperFamilySSF466894.39E-2911108IPR009057Homeodomain-like
SMARTSM007172.6E-131363IPR001005SANT/Myb domain
PfamPF002496.4E-161461IPR001005SANT/Myb domain
CDDcd001672.47E-111661No hitNo description
PROSITE profilePS5129425.32362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2565115IPR009057Homeodomain-like
SMARTSM007174.4E-1766114IPR001005SANT/Myb domain
PfamPF002492.0E-1567112IPR001005SANT/Myb domain
PfamPF066401.5E-4128309IPR010588Myb-related protein P, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTRE EDEILAKYIK EHGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI SEEEEEMIIK LHATLGNRWS LIAGHLPGRT DNEIKNYWNS HLSRRAHDFR  120
KGGDGVVVNV DISKLPGGGK RRGGRASRAA AAATAKGKGK GKGKKATKEK DNKVTEAKHH  180
HKEEEEDGSM NNVVSTPSSC EPCTAAIQGD SEQGQASASG VTSDGLEEGP LRLSEEMVSG  240
PVGPESPKQG VCPESPKQDV GPNGSCNEGE SWPIGMAEAV GQDELGDKAM EWDLMGLDND  300
LANGDMWGSL VWDYDCMVVP DGGQQQGEVM SDLFFLDSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-24121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1159165KGKGKKA
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000392G0510
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0927671e-136FP092767.1 Phyllostachys edulis cDNA clone: bphylf059d01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565704.11e-134transcription factor MYB111
TrEMBLI1HEV81e-132I1HEV8_BRADI; Uncharacterized protein
STRINGBRADI2G11676.11e-133(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.12e-71myb domain protein 12