PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000358G0390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 288aa    MW: 30238.9 Da    PI: 4.7949
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000358G0390genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd+ l  +++++G+g +W + +++ g++R++k+c++rw++yl
  PH01000358G0390 14 RGPWSPEEDDALRVYIQRHGTGgSWISLPKKAGLRRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding41.62.9e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T eEd +++ +   lG++ W++Ia+++  +Rt++++k++w++
  PH01000358G0390  69 GDFTDEEDAIIISLYSTLGSK-WSLIASRLE-RRTDNDVKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.702962IPR017930Myb domain
SuperFamilySSF466891.33E-2612109IPR009057Homeodomain-like
SMARTSM007171.6E-101364IPR001005SANT/Myb domain
PfamPF002498.9E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-231569IPR009057Homeodomain-like
CDDcd001675.07E-81662No hitNo description
PROSITE profilePS5129422.3663117IPR017930Myb domain
SMARTSM007172.1E-1267115IPR001005SANT/Myb domain
PfamPF002494.5E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-2370117IPR009057Homeodomain-like
CDDcd001676.45E-1071113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGRSPCCDRA AVKRGPWSPE EDDALRVYIQ RHGTGGSWIS LPKKAGLRRC GKSCRLRWLN  60
YLRPDIRHGD FTDEEDAIII SLYSTLGSKW SLIASRLERR TDNDVKNYWN TKLKKRLAAA  120
AAAASSIPSP SFLPLPLPAP ASALAPVPTH PSLLPLAIPT VKMETYTCDD FLVPAEFQDP  180
FAGCADADGS TSASAASSAS NWPADNGTAD GGGLFPDLCM GSDLVADGST SASAASSASN  240
WLADNGTADG GGLFPDLCMG SDLAAAASAD PFLAGYYYPI DPSFSLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-22141177108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000358G0390
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519081e-134JF951908.1 Triticum aestivum clone TaMYB25 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025817369.15e-95transcription factor RAX1-like
RefseqXP_025817370.15e-95transcription factor RAX1-like
TrEMBLA0A3L6SQD02e-99A0A3L6SQD0_PANMI; Transcription factor RAX2-like
STRINGSi002629m5e-94(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.12e-64MYB family protein