PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01000309G0470 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 173aa MW: 19945.2 Da PI: 7.6289 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 28 | 5.1e-09 | 13 | 59 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45 r++W++eEd+ + a + + + +W+++a+ ++ gRt+ + +++q PH01000309G0470 13 RLPWSKEEDKVFESALVLCPEHapdRWALVAAQLP-GRTPQEAWEHYQ 59 89******************99*************.****98777777 PP | |||||||
2 | Myb_DNA-binding | 43.5 | 7.3e-14 | 106 | 150 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +W++eE+ l++++ +++G g+W+ I+r Rt+ q+ s+ qky PH01000309G0470 106 PWSEEEHRLFLEGLEKYGRGDWRNISRFSVRSRTPTQVASHAQKY 150 7*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 10.394 | 8 | 66 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.59E-11 | 10 | 61 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 4.5E-7 | 11 | 61 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.5E-5 | 12 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.4E-7 | 13 | 59 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.10E-5 | 15 | 53 | No hit | No description |
PROSITE profile | PS51294 | 18.351 | 99 | 155 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.31E-17 | 101 | 156 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.1E-11 | 103 | 153 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 6.0E-17 | 104 | 154 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 3.2E-11 | 106 | 150 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.82E-11 | 106 | 151 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.3E-11 | 106 | 149 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MDFYRAAGRP VTRLPWSKEE DKVFESALVL CPEHAPDRWA LVAAQLPGRT PQEAWEHYQA 60 LVADVDLIER GAVDFPGCWD EDDNKDGAPD RRAGKSRGEE RRRGIPWSEE EHRLFLEGLE 120 KYGRGDWRNI SRFSVRSRTP TQVASHAQKY FIRQTNAATR DSKRKSIHDI TTP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 9e-16 | 1 | 77 | 1 | 72 | RADIALIS |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01000309G0470 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP096878 | 0.0 | FP096878.1 Phyllostachys edulis cDNA clone: bphyem104c18, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003567296.1 | 5e-95 | transcription factor DIVARICATA | ||||
Swissprot | Q8S9H7 | 8e-46 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A1D8F0J8 | 1e-124 | A0A1D8F0J8_9POAL; MYB protein | ||||
STRING | EMT13974 | 2e-87 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2895 | 36 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38090.1 | 4e-50 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|