PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000305G0990
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 264aa    MW: 29168.8 Da    PI: 10.3726
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000305G0990genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++lv ++ q+G ++W++ ++  g+ R++k+c++rw +yl
  PH01000305G0990 14 KGAWSPEEDQRLVAYIGQHGHPNWRALPKQAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.42.4e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++Tt+E++l+v++++ lG+  W++Ia+ ++ gRt++++k+ w+++l
  PH01000305G0990  67 RGNFTTDEEDLIVRLHHTLGNS-WSAIAAQLP-GRTDNEIKNVWHTHL 112
                      89******************99.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129423.686965IPR017930Myb domain
SuperFamilySSF466891.72E-2811108IPR009057Homeodomain-like
SMARTSM007171.3E-121363IPR001005SANT/Myb domain
PfamPF002492.9E-151461IPR001005SANT/Myb domain
CDDcd001673.06E-101661No hitNo description
Gene3DG3DSA:1.10.10.603.1E-2565116IPR009057Homeodomain-like
SMARTSM007171.5E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129418.89166116IPR017930Myb domain
PfamPF002496.0E-1567112IPR001005SANT/Myb domain
CDDcd001678.89E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MGRAPCCEKE GLRKGAWSPE EDQRLVAYIG QHGHPNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TTDEEDLIVR LHHTLGNSWS AIAAQLPGRT DNEIKNVWHT HLKKRLDDDR  120
KVGDGGGRQQ RKPKSKSAAG KAVDHEQFTA SPGRSSNITT SSGVTCSTVT ESAAAVSSSA  180
DNAATTSASH SGHQHQLVKE ESFSSAEFPI PPIIDESFWS STDVKVDPIC IPTYHSKKSK  240
QNQRIIKIPK ITKKRARTRR DSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-25121175109B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000305G0990
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269|PubMed:19161942}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1090111e-128AK109011.1 Oryza sativa Japonica Group cDNA clone:002-153-H11, full insert sequence.
GenBankCT8347441e-128CT834744.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA107G14, full insert sequence.
GenBankY113501e-128Y11350.1 O.sativa mRNA for myb factor, 1084 bp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664815.11e-105PREDICTED: myb-related protein Myb4-like
SwissprotQ9LTC48e-75MYB15_ARATH; Transcription factor MYB15
TrEMBLJ3KU271e-104J3KU27_ORYBR; Uncharacterized protein
STRINGOB0039G10010.11e-104(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.15e-67myb domain protein 15
Publications ? help Back to Top
  1. Schnaubelt D, et al.
    Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana.
    Plant Cell Environ., 2015. 38(2): p. 266-79
    [PMID:24329757]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Ma X, et al.
    CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana.
    Plant Mol. Biol., 2015. 88(3): p. 287-99
    [PMID:25948280]
  4. Kim SH, et al.
    Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis.
    Nucleic Acids Res., 2017. 45(11): p. 6613-6627
    [PMID:28510716]
  5. Chezem WR,Memon A,Li FS,Weng JK,Clay NK
    SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(8): p. 1907-1926
    [PMID:28733420]
  6. Pal S, et al.
    TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation.
    Plant Physiol., 2017. 175(2): p. 916-926
    [PMID:28827455]