PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000302G0910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 296aa    MW: 32877.2 Da    PI: 6.127
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000302G0910genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.2e-184895148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT +Ed+ lv+ ++ +G g+W++ art g++Rt+k+c++rw++yl
  PH01000302G0910 48 RGPWTVDEDLTLVNFIADHGEGRWNSLARTAGLKRTGKSCRLRWLNYL 95
                     89********************************************97 PP

2Myb_DNA-binding51.91.7e-16101144146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  PH01000302G0910 101 RGNLTADEQLLILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 144
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4674395IPR017930Myb domain
SuperFamilySSF466892.43E-2946142IPR009057Homeodomain-like
SMARTSM007172.4E-134797IPR001005SANT/Myb domain
PfamPF002494.2E-154895IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-2149102IPR009057Homeodomain-like
CDDcd001671.72E-95095No hitNo description
PROSITE profilePS5129423.21896150IPR017930Myb domain
SMARTSM007172.8E-14100148IPR001005SANT/Myb domain
PfamPF002497.3E-15101144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-23103149IPR009057Homeodomain-like
CDDcd001673.04E-10105144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MASSSERSRS GGGGGGGGGN TKAMACSLAL LDDDLHRGVL QEEAEFRRGP WTVDEDLTLV  60
NFIADHGEGR WNSLARTAGL KRTGKSCRLR WLNYLRPDVK RGNLTADEQL LILDLHSRWG  120
NRWSKIAQHL PGRTDNEIKN YWRTRVQKHA KQLNCDANSN RFKDAMRYLW MPRLVDQRLQ  180
HAAGFGDHGH GHGDTADAHA VSGLASMGYM ESSSMVTPSS SESFASESYD GDLYASVHAG  240
EMLNAGDWMQ EAANQGLWSE SAQDTNSQFQ DPELTGWVQG FSENFWSLED IWKVQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-2445142197MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-244414223120MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in the jasmonate-dependent defense responses to the rice blast fungus Magnaporthe oryzae. Does not seem to function in the salicylic acid-dependent signaling pathway. {ECO:0000269|PubMed:11310740}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000302G0910
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA), wounding and infection by the fungal pathogen Magnaporthe oryzae. {ECO:0000269|PubMed:11310740}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4061841e-142CU406184.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C108M20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020162380.11e-126myb-related protein 340-like
SwissprotQ2QZJ81e-108JAMYB_ORYSJ; Transcription factor JAMYB
TrEMBLF2D9I91e-126F2D9I9_HORVV; Predicted protein
STRINGMLOC_6821.21e-126(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.11e-76myb domain protein 112
Publications ? help Back to Top
  1. Ahn IP,Kim S,Kang S,Suh SC,Lee YH
    Rice Defense Mechanisms Against Cochliobolus miyabeanus and Magnaporthe grisea Are Distinct.
    Phytopathology, 2005. 95(11): p. 1248-55
    [PMID:18943354]
  2. Campos-Soriano L,García-Martínez J,San Segundo B
    The arbuscular mycorrhizal symbiosis promotes the systemic induction of regulatory defence-related genes in rice leaves and confers resistance to pathogen infection.
    Mol. Plant Pathol., 2012. 13(6): p. 579-92
    [PMID:22212404]
  3. Yokotani N, et al.
    Role of the rice transcription factor JAmyb in abiotic stress response.
    J. Plant Res., 2013. 126(1): p. 131-9
    [PMID:22847900]
  4. Wang D, et al.
    Expression analysis of innate immunity related genes in the true/field blast resistance gene-mediated defence response.
    Biotechnol. Biotechnol. Equip., 2014. 28(6): p. 999-1007
    [PMID:26740780]
  5. Fred AK,Kiswara G,Yi G,Kim KM
    Screening Rice Cultivars for Resistance to Bacterial Leaf Blight.
    J. Microbiol. Biotechnol., 2016. 26(5): p. 938-45
    [PMID:26869604]