PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000209G0490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 317aa    MW: 34250 Da    PI: 8.0904
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000209G0490genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-175499147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed +l+++v+q+G+ +W++Ia+++  gR++k+c++rw++ 
  PH01000209G0490 54 RGHWRPAEDARLKELVAQYGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 99
                     899*****************************.***********996 PP

2Myb_DNA-binding57.43.4e-18106150147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r ++++eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ +
  PH01000209G0490 106 RRAFSEEEEERLLAAHRAYGNK-WALIARLFP-GRTDNAVKNHWHVL 150
                      678*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.59549100IPR017930Myb domain
SMARTSM007175.7E-1453102IPR001005SANT/Myb domain
SuperFamilySSF466895.62E-2854147IPR009057Homeodomain-like
PfamPF002494.3E-165499IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2655107IPR009057Homeodomain-like
CDDcd001672.26E-135798No hitNo description
PROSITE profilePS5129427.733101155IPR017930Myb domain
SMARTSM007178.8E-16105153IPR001005SANT/Myb domain
PfamPF002493.6E-15106150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-21108154IPR009057Homeodomain-like
CDDcd001676.77E-8117151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0071367Biological Processcellular response to brassinosteroid stimulus
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MAHEMSGGFF GHPPPPAPFQ EQLVVEDEGY HGHVDEAEEG GHGGGGVQGK LCARGHWRPA  60
EDARLKELVA QYGPQNWNLI AEKLDGRSGK SCRLRWFNQL DPRINRRAFS EEEEERLLAA  120
HRAYGNKWAL IARLFPGRTD NAVKNHWHVL MARKQREQSG AFRRRKPSSS SSSPSSPVPP  180
PHLLPVVALH HHHHGSPLPL HQNQYSTAAA AHAQAQQYNA AAATRAYSGG ESDESASTCT  240
TDLSLSAGSA AVPCFYHQSY DMVPQATAPL AAFAPSARSA FSAPSSARVR REAAADQGSG  300
DKLTLPFFDF LGVGAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-33541544104C-Myb DNA-Binding Domain
1msf_C2e-33541544104C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269|PubMed:20305120}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000209G0490
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding. {ECO:0000269|PubMed:20305120}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1074611e-143AK107461.1 Oryza sativa Japonica Group cDNA clone:002-129-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457638.11e-128transcription factor MYB117
SwissprotQ5NBM81e-107CSA_ORYSJ; Transcription factor CSA
TrEMBLC5XH761e-127C5XH76_SORBI; Uncharacterized protein
STRINGSb03g010960.11e-128(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-57myb domain protein 105
Publications ? help Back to Top
  1. Leonard LM,Follette VM
    Sexual functioning in women reporting a history of child sexual abuse: review of the empirical literature and clinical implications.
    Annu Rev Sex Res, 2002. 13: p. 346-88
    [PMID:12836736]
  2. Wang L,Li X,Chen Z
    Sulfated modification of the polysaccharides obtained from defatted rice bran and their antitumor activities.
    Int. J. Biol. Macromol., 2009. 44(2): p. 211-4
    [PMID:19135473]
  3. Wang L,Huang H,Wei Y,Li X,Chen Z
    Characterization and anti-tumor activities of sulfated polysaccharide SRBPS2a obtained from defatted rice bran.
    Int. J. Biol. Macromol., 2009. 45(4): p. 427-31
    [PMID:19549538]
  4. Zhang H, et al.
    Carbon starved anther encodes a MYB domain protein that regulates sugar partitioning required for rice pollen development.
    Plant Cell, 2010. 22(3): p. 672-89
    [PMID:20305120]
  5. Zhang H, et al.
    Mutation in CSA creates a new photoperiod-sensitive genic male sterile line applicable for hybrid rice seed production.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(1): p. 76-81
    [PMID:23256151]
  6. Zhu X, et al.
    Brassinosteroids promote development of rice pollen grains and seeds by triggering expression of Carbon Starved Anther, a MYB domain protein.
    Plant J., 2015. 82(4): p. 570-81
    [PMID:25754973]
  7. Li X, et al.
    Metabolic and transcriptomic signatures of rice floral organs reveal sugar starvation as a factor in reproductive failure under heat and drought stress.
    Plant Cell Environ., 2015. 38(10): p. 2171-92
    [PMID:25828772]
  8. Shaar-Moshe L,Hübner S,Peleg Z
    Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach.
    BMC Plant Biol., 2015. 15: p. 111
    [PMID:25935420]