PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000169G1060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 322aa    MW: 34102.2 Da    PI: 7.7312
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000169G1060genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.6e-191257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+W++eEd+ l ++v+++G ++W++I r+++ gR++k+c++rw + 
  PH01000169G1060 12 RGPWSPEEDDALRRLVERHGARNWTAIGREIP-GRSGKSCRLRWCNQ 57
                     89******************************.***********985 PP

2Myb_DNA-binding51.42.6e-1664106145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r ++T+eEd  +++a+++lG++ W++Iar +  gRt++ +k++w+
  PH01000169G1060  64 RRPFTAEEDATIIRAHARLGNR-WAAIARLLH-GRTDNAVKNHWN 106
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.274762IPR017930Myb domain
SuperFamilySSF466898.03E-319105IPR009057Homeodomain-like
SMARTSM007175.3E-171160IPR001005SANT/Myb domain
PfamPF002491.6E-181257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-251365IPR009057Homeodomain-like
CDDcd001673.31E-161456No hitNo description
SMARTSM007171.4E-1463111IPR001005SANT/Myb domain
PfamPF002494.2E-1464106IPR001005SANT/Myb domain
PROSITE profilePS5129418.8664113IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-2366113IPR009057Homeodomain-like
CDDcd001673.59E-1166106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGGGEVDCDR IRGPWSPEED DALRRLVERH GARNWTAIGR EIPGRSGKSC RLRWCNQLSP  60
QVERRPFTAE EDATIIRAHA RLGNRWAAIA RLLHGRTDNA VKNHWNCSLK RKLAVATAGA  120
TGVTGGPEFE RPCKRVSPAP DSPSGSGSGS GSDRSDLSHG GGAFGQIYRP VARTGGFEPA  180
DCAISRRHEE EPLTSLSLSL PGMNQGLNHD SAHSQFQELP PSPSPPPPPV AATPSYPFSP  240
EFMAAMQEMI RAEVQNYMAS VGVRGGCGTT GGAEVQNYMA SVGVRGGCGT AGGTDLFMPQ  300
LMEGVMRAAA AERVAGLGGC SD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-38111133105C-Myb DNA-Binding Domain
1msf_C2e-38111133105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000169G1060
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0933540.0FP093354.1 Phyllostachys edulis cDNA clone: bphyem209d17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641187.11e-137transcription factor MYB77
SwissprotO231601e-67MYB73_ARATH; Transcription factor MYB73
TrEMBLA0A0E0LDT21e-136A0A0E0LDT2_ORYPU; Uncharacterized protein
STRINGOPUNC06G19910.11e-137(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.16e-58myb domain protein r1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]