PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000161G0030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 300aa    MW: 32643.3 Da    PI: 6.2325
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000161G0030genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.3e-141462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd  l+ +++++G   +W + ++++g++R++k+c++rw++yl
  PH01000161G0030 14 RGPWSPEEDAVLKSYIEEHGAVgNWIALPHKIGLKRCGKSCRLRWLNYL 62
                     89******************879************************97 PP

2Myb_DNA-binding36.88.9e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eEd ++  +    G++ W+ Ia+ +  gRt++++k++w++
  PH01000161G0030  69 GDFTPEEDSIICSLYISIGSR-WSIIAAQLS-GRTDNDVKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.465962IPR017930Myb domain
SuperFamilySSF466892.5E-2512109IPR009057Homeodomain-like
SMARTSM007176.0E-111364IPR001005SANT/Myb domain
PfamPF002494.6E-131462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-241569IPR009057Homeodomain-like
CDDcd001674.23E-91662No hitNo description
PROSITE profilePS5129420.52863117IPR017930Myb domain
SMARTSM007172.1E-1067115IPR001005SANT/Myb domain
PfamPF002495.9E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-2270117IPR009057Homeodomain-like
CDDcd001676.67E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGRAPCCDKA TVKRGPWSPE EDAVLKSYIE EHGAVGNWIA LPHKIGLKRC GKSCRLRWLN  60
YLRPNIKHGD FTPEEDSIIC SLYISIGSRW SIIAAQLSGR TDNDVKNYWN TKLKKRLLGR  120
RKDHDAHHHG QSAANEPSVD SANDGERCAQ ALSASAVERI QLCMQLQELH NPLSVVQNPL  180
LWPNRATQSS NSGSGFNVTV AEQGQSGSLN GHLNGQLDGL ASPSSAENSN VVAIEAELQE  240
LLYGEGGRGR AGAAMDGGAA QQGDVDWWSY DQGKPPVNCW DFTPETSSVF QDCTSVYDI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A7e-21141172103MYB3
3zqc_D7e-21141172103MYB3
3zqc_G7e-21141172103MYB3
3zqc_J7e-21141172103MYB3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000161G0030
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117881e-146AK111788.1 Oryza sativa Japonica Group cDNA clone:J023093J22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973097.11e-164transcription factor MYB36
SwissprotQ9FKL21e-82MYB36_ARATH; Transcription factor MYB36
TrEMBLK3YMV21e-162K3YMV2_SETIT; Uncharacterized protein
STRINGSi015585m1e-163(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-76myb domain protein 36
Publications ? help Back to Top
  1. Fernández-Marcos M, et al.
    Control of Arabidopsis lateral root primordium boundaries by MYB36.
    New Phytol., 2017. 213(1): p. 105-112
    [PMID:27891649]