PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01000083G0130 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 154aa MW: 17682.9 Da PI: 9.454 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 180.1 | 5.6e-56 | 10 | 139 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 +ppGfrFhPtdeelv++yL++kv+++++ l +vik+vd+yk+ePwdL++ ++ a e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+ PH01000083G0130 10 VPPGFRFHPTDEELVDYYLREKVASTRIGL-NVIKDVDLYKIEPWDLQEkcRIGAeEQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKP 102 69**************************99.99**************953444442556*********************************** PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 +++ k++lvg++ktLv+ykgrap+g+k+dW+mheyrle PH01000083G0130 103 IYA-KHSLVGMRKTLVYYKGRAPNGHKSDWIMHEYRLE 139 ***.8899****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.32E-58 | 5 | 144 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.309 | 10 | 153 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.6E-29 | 11 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MSSTQAQAQV PPGFRFHPTD EELVDYYLRE KVASTRIGLN VIKDVDLYKI EPWDLQEKCR 60 IGAEEQNEWY FFSHKDKKYP TGTRTNRATA AGFWKATGRD KPIYAKHSLV GMRKTLVYYK 120 GRAPNGHKSD WIMHEYRLET NENGPPQAST AVN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 2e-52 | 3 | 138 | 8 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01000083G0130 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001304791.1 | 5e-97 | NAC domain-containing protein 7-like | ||||
Refseq | XP_014754958.1 | 5e-97 | NAC domain-containing protein 7-like isoform X1 | ||||
Swissprot | F4HYV5 | 1e-88 | NAC26_ARATH; NAC domain-containing protein 26 | ||||
TrEMBL | M8BQ35 | 2e-96 | M8BQ35_AEGTA; NAC domain-containing protein 7 | ||||
STRING | BRADI1G52187.2 | 2e-96 | (Brachypodium distachyon) | ||||
STRING | EMT24079 | 4e-97 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2370 | 38 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G62700.1 | 3e-80 | Arabidopsis NAC domain containing protein 26 |
Publications ? help Back to Top | |||
---|---|---|---|
|