PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000068G1000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 338aa    MW: 36928.1 Da    PI: 8.2656
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000068G1000genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw++yl
  PH01000068G1000 14 RGLWSPEEDEKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWLNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding52.21.4e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++eE++l+++++ +lG++ W+ Ia  ++ gRt++++k++w++y
  PH01000068G1000  67 RGAFSQEEEDLIIHLHSMLGNK-WSQIAVQLP-GRTDNEVKNFWNSY 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-26664IPR009057Homeodomain-like
PROSITE profilePS5129418.955961IPR017930Myb domain
SuperFamilySSF466891.76E-2912108IPR009057Homeodomain-like
SMARTSM007171.7E-131363IPR001005SANT/Myb domain
PfamPF002494.1E-161461IPR001005SANT/Myb domain
CDDcd001673.76E-121761No hitNo description
PROSITE profilePS5129426.08262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2565116IPR009057Homeodomain-like
SMARTSM007172.4E-1566114IPR001005SANT/Myb domain
PfamPF002492.8E-1567111IPR001005SANT/Myb domain
CDDcd001677.47E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MAKRPCGTKK KLRRGLWSPE EDEKLMNHIA KYGHGCWSSV PKLAGLERCG KSCRLRWLNY  60
LRPDLKRGAF SQEEEDLIIH LHSMLGNKWS QIAVQLPGRT DNEVKNFWNS YIKKKLRQRG  120
IDPATHKPLG RHSRRPHGGV QRGRAHPIIS GPAESYMYSR SRTDGAGASA SAYAAVGGAC  180
SDGSLSLSGY NQTADFTGYL DADALHCGPS STVHPAVIPS VSSSSTLNSM AGLSPDAATT  240
TTTTDEQCNN HINSSGGFDS TQSSTTATNH LPWRELRPSS ACTDDHYGAA LDELKWSDYV  300
FDGYQLQYQG IQGQCIYGDS KDTVQFDVHG LSSWCLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28121165108B-MYB
1h8a_C4e-281111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000068G1000
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ4773310.0KJ477331.1 Indosasa hispida MYB transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020154053.11e-139transcription factor MYB3-like
TrEMBLA0A0D3Q1Y60.0A0A0D3Q1Y6_9POAL; MYB transcription factor
STRINGTraes_2BS_E1E541767.11e-132(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-74myb domain protein 86