PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000066G1200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 274aa    MW: 29409.3 Da    PI: 9.2227
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000066G1200genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+ ++k +G g+W++ ++  g+ R++k+c++rw +yl
  PH01000066G1200 14 KGAWTKEEDRRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.74.2e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T ++de++++++++lG++ W++Ia  ++ gRt++++k++w+++
  PH01000066G1200  67 RGNFTGDDDEIIIKLHALLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.051961IPR017930Myb domain
SuperFamilySSF466891.35E-2813108IPR009057Homeodomain-like
SMARTSM007175.5E-141363IPR001005SANT/Myb domain
PfamPF002493.5E-151461IPR001005SANT/Myb domain
CDDcd001675.66E-121661No hitNo description
PROSITE profilePS5129426.41962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2665116IPR009057Homeodomain-like
SMARTSM007172.4E-1566114IPR001005SANT/Myb domain
PfamPF002495.2E-1467111IPR001005SANT/Myb domain
CDDcd001671.20E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDRRLIAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY  60
LRPDLKRGNF TGDDDEIIIK LHALLGNKWS LIAGQLPGRT DNEIKNYWNT HIKRKLLNRG  120
IDPQTHRPIS AGSSAGAAGS GLTTASTAGF PSPAPASRLS NPVLTVPSNV NFSARPAPSE  180
DGHSSSGGST DNATRCPDLN LDLDLDLSMG LPCSPPKTPT AASTPTSQRQ QTTICLCYHL  240
GVRSGEACSC KTASPAGPRA FQFLRPLEEG QYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141167108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000066G1200
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0997320.0FP099732.1 Phyllostachys edulis cDNA clone: bphylf047p14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456719.11e-160myb-related protein 308
SwissprotP813931e-93MYB08_ANTMA; Myb-related protein 308
TrEMBLC5XRB41e-158C5XRB4_SORBI; Uncharacterized protein
STRINGSb03g041360.11e-159(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.14e-87myb domain protein 4
Publications ? help Back to Top
  1. Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C
    Expression patterns of myb genes from Antirrhinum flowers.
    Plant Cell, 1991. 3(2): p. 115-25
    [PMID:1840903]