PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000064G1730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 301aa    MW: 32262.8 Da    PI: 7.5005
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000064G1730genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.3e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ lv ++++ G+g+W++++ + g+ R+ k+c++rw +yl
  PH01000064G1730 14 KGPWTPEEDLVLVSYIQEQGPGNWRAVPTRTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding47.73.6e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++l+v++ ++lG++ W++ a++++  Rt++++k++w+++l
  PH01000064G1730  67 RGNFTDQEEKLIVHLQALLGNR-WAAMASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-23564IPR009057Homeodomain-like
PROSITE profilePS5129423.064965IPR017930Myb domain
SuperFamilySSF466892.47E-2811108IPR009057Homeodomain-like
SMARTSM007171.6E-111363IPR001005SANT/Myb domain
PfamPF002491.8E-141461IPR001005SANT/Myb domain
CDDcd001677.72E-101661No hitNo description
Gene3DG3DSA:1.10.10.608.1E-2465116IPR009057Homeodomain-like
SMARTSM007173.6E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129418.63566116IPR017930Myb domain
PfamPF002497.6E-1467112IPR001005SANT/Myb domain
CDDcd001678.00E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MVRPPCCDKE GVKKGPWTPE EDLVLVSYIQ EQGPGNWRAV PTRTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKLIVH LQALLGNRWA AMASYLPERT DNDIKNYWNT HLKRKLQSGS  120
AAASVPAAQR PASSSKGRWE RRLQTDINMA RHALREALTS LEDVKPKPDA GGAGAADTDS  180
PASSSSGASQ SSPSSAGYVL TTENISRMLD GWARKGCTGS GPTTPGATES ASGSSEASDV  240
SYGAAARALG SVFEYETKPA VGAPELTHLS AIESWLFADD SNDHHSQGGS LLDAAMDYSF  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-25141164105MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-25141164105C-Myb DNA-Binding Domain
1msf_C1e-25141164105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to the promoters of genes involved in cuticular wax biosynthesis. Transactivates WSD1, KCS2/DAISY, CER1, CER2, FAR3 and ECR genes (PubMed:25305760, PubMed:27577115). Functions together with MYB96 in the activation of cuticular wax biosynthesis (PubMed:27577115). {ECO:0000269|PubMed:25305760, ECO:0000269|PubMed:27577115}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000064G1730
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress, osmotic shock and abscisic acid (ABA). {ECO:0000269|PubMed:25305760}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0426110.0BT042611.1 Zea mays full-length cDNA clone ZM_BFb0368F24 mRNA, complete cds.
GenBankKJ7275330.0KJ727533.1 Zea mays clone pUT5393 MYB transcription factor (MYB94) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020168716.11e-147transcription factor MYB30-like
SwissprotQ9SN789e-96MYB94_ARATH; Transcription factor MYB94
TrEMBLA0A1D6RPP61e-146A0A1D6RPP6_WHEAT; Uncharacterized protein
TrEMBLA0A453B0T71e-146A0A453B0T7_AEGTS; Uncharacterized protein
STRINGSi030560m1e-146(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.16e-89myb domain protein 30
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Cui F, et al.
    Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation.
    Mol Plant, 2016. 9(6): p. 926-38
    [PMID:27060495]
  4. Lee SB,Kim HU,Suh MC
    MYB94 and MYB96 Additively Activate Cuticular Wax Biosynthesis in Arabidopsis.
    Plant Cell Physiol., 2016. 57(11): p. 2300-2311
    [PMID:27577115]