PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000053G1340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 310aa    MW: 34152.7 Da    PI: 7.0255
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000053G1340genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  PH01000053G1340 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPISTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding47.54e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+ ++v++  +lG++ W++Ia++++  Rt++++k++w+++l
  PH01000053G1340  67 RGNFTPHEEGIIVHLQSLLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.576965IPR017930Myb domain
SuperFamilySSF466892.85E-3011108IPR009057Homeodomain-like
SMARTSM007171.2E-121363IPR001005SANT/Myb domain
PfamPF002491.5E-151461IPR001005SANT/Myb domain
CDDcd001671.75E-111661No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129418.89866116IPR017930Myb domain
SMARTSM007172.4E-1366114IPR001005SANT/Myb domain
PfamPF002495.4E-1367112IPR001005SANT/Myb domain
CDDcd001675.28E-969110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PISTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEGIIVH LQSLLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKHQ  120
AMGAIFASSS SAESINPTAA GHVLDHHHHM IATSNSMVDS YGRGAACSNP EVAQMITRRW  180
PFDADCSSTT SSYASSMDNI SKLLNGFMKS SPPQNGAADV KPGIIEVNPL LSFDRMPGTG  240
AELTFTAVQQ QQQQPASLLE QCSYDDIETK QQQLAPLSSI EKWLFDEAAE QVADLMDLSD  300
GCCSVPMLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-25141164105MYB PROTO-ONCOGENE PROTEIN
1h8a_C4e-251211625128MYB TRANSFORMING PROTEIN
1mse_C3e-25141164105C-Myb DNA-Binding Domain
1msf_C3e-25141164105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000053G1340
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0926810.0FP092681.1 Phyllostachys edulis cDNA clone: bphyem110c07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025827828.11e-137transcription factor MYB30-like
SwissprotB3VTV72e-96MYB60_VITVI; Transcription factor MYB60
TrEMBLL0P1U90.0L0P1U9_9POAL; PH01B001E05.10 protein
STRINGSi026651m1e-136(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.19e-85myb domain protein 60
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]