PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000043G2100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 298aa    MW: 31755.7 Da    PI: 9.836
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000043G2100genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.2e-191156147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l ++v+++G ++W++I r ++ gR++k+c++rw + 
  PH01000043G2100 11 KGPWSPEEDEALRRLVERHGARNWTAIGRGIP-GRSGKSCRLRWCNQ 56
                     79******************************.***********985 PP

2Myb_DNA-binding53.65.3e-1763106146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eEd  +++a+++lG++ W++Iar ++ gRt++ +k++w++
  PH01000043G2100  63 RRPFTAEEDADILRAHARLGNR-WAAIARLLP-GRTDNAVKNHWNS 106
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.481661IPR017930Myb domain
SuperFamilySSF466895.24E-318104IPR009057Homeodomain-like
SMARTSM007179.6E-171059IPR001005SANT/Myb domain
PfamPF002493.8E-181156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-251264IPR009057Homeodomain-like
CDDcd001673.63E-161355No hitNo description
SMARTSM007174.2E-1562110IPR001005SANT/Myb domain
PfamPF002495.8E-1563106IPR001005SANT/Myb domain
PROSITE profilePS5129419.71463112IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2365112IPR009057Homeodomain-like
CDDcd001675.87E-1265108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGAEAECDRI KGPWSPEEDE ALRRLVERHG ARNWTAIGRG IPGRSGKSCR LRWCNQLSPQ  60
VERRPFTAEE DADILRAHAR LGNRWAAIAR LLPGRTDNAV KNHWNSSLKR RLATATATAT  120
AAAAGHGGEA DRPSKRASPG PCSPTGSDRS ELSQGGCGGG QVFRPVPRAG GFDAVSADVR  180
PPPPRRDEDP LTSLSLSLPG LDQGFHHDSA RSHFQELSPS SRSPSPPSPP PPPSSYPFSA  240
ELVAAMQEMI RTEVRKYMSG VGLRAGCGPG AVGEACMPQL VAGVMRAAAE RVGVVTRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-4181144110B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00653PBMTransfer from LOC_Os02g09480Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000043G2100
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0920700.0FP092070.1 Phyllostachys edulis cDNA clone: bphylf042j13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020180953.11e-165transcription factor MYB44-like
TrEMBLA0A446W9H01e-166A0A446W9H0_TRITD; Uncharacterized protein
STRINGMLOC_7426.11e-162(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-63myb domain protein r1