PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000030G0050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 364aa    MW: 39417.2 Da    PI: 4.7815
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000030G0050genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
  PH01000030G0050 16 KGSWTPEEDMRLIAYIQKYGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                     799*****************************99************97 PP

2Myb_DNA-binding48.71.8e-1569114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+   ++++ +lG++ W++Ia++++ gRt++++k+ w+++l
  PH01000030G0050  69 RGNFTAEEEATVIKLHGLLGNK-WSKIASCLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-24766IPR009057Homeodomain-like
PROSITE profilePS5129415.1951163IPR017930Myb domain
SuperFamilySSF466895.99E-3013110IPR009057Homeodomain-like
SMARTSM007172.3E-131565IPR001005SANT/Myb domain
PfamPF002492.8E-151663IPR001005SANT/Myb domain
CDDcd001673.09E-111863No hitNo description
PROSITE profilePS5129423.87664118IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2567117IPR009057Homeodomain-like
SMARTSM007176.6E-1468116IPR001005SANT/Myb domain
PfamPF002498.3E-1469114IPR001005SANT/Myb domain
CDDcd001671.22E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MGKGRAPCCA KVGLNKGSWT PEEDMRLIAY IQKYGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTAEEEATV IKLHGLLGNK WSKIASCLPG RTDNEIKNVW NTHLKKRVAP  120
SAGEQKKDGA KSKKKTTCVD VTVPSPSPSS STTTTNCSSG DSGEQSNTSK EELDRIEIPM  180
LDPGFDFDML VDPMPETYCP AVSLPTSPCS STSPPCVRGV DELLDLPEID IEPELWSIID  240
GDTGGDSCTE TTPAPLSNAA PSHGNATEAS AATTSQEEGK EWWLQDLEWE LGLWGPMEDY  300
QYHPGPQSQA CRVDPLSAIV EDPVSCYFQA GPTFQGPESS AALLTSTQPD GFVRSLSPVR  360
SLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-281411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000030G0050
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1119601e-163AK111960.1 Oryza sativa Japonica Group cDNA clone:001-031-D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020185012.11e-174myb-related protein Zm1-like
SwissprotP200241e-117MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A453CWE91e-173A0A453CWE9_AEGTS; Uncharacterized protein
STRINGOB04G30570.11e-170(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.12e-70myb domain protein 63
Publications ? help Back to Top
  1. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]