PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000029G1950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 588aa    MW: 63493.8 Da    PI: 6.5814
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000029G1950genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-16136183148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT  Ed +lvd+vk++G g+W+++ +  g+ R++k+c++rw ++l
  PH01000029G1950 136 KGPWTSAEDAILVDYVKKHGEGNWNAVQKNTGLFRCGKSCRLRWANHL 183
                      79******************************************9986 PP

2Myb_DNA-binding44.82.8e-14189232146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ l+++++ ++ ++ W++ a++++ gRt++++k++w++
  PH01000029G1950 189 KGAFTAEEERLIIQLHFKMRNK-WARMAAHLP-GRTDNEIKNYWNT 232
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.715131187IPR017930Myb domain
SuperFamilySSF466892.19E-29133230IPR009057Homeodomain-like
SMARTSM007172.1E-14135185IPR001005SANT/Myb domain
PfamPF002491.2E-14136183IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-23137190IPR009057Homeodomain-like
CDDcd001672.98E-11138183No hitNo description
PROSITE profilePS5129417.795188238IPR017930Myb domain
SMARTSM007177.6E-15188236IPR001005SANT/Myb domain
PfamPF002492.0E-13189232IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-23191236IPR009057Homeodomain-like
CDDcd001673.73E-11191232No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MLSGFHTTTE PLLKPPARRP REKESPSAAP GRDQERRLKW LGDGVEARRG RSGESDWKSR  60
RKISILADAE NCMSTAPLMV PTARYGASGA SAISSALCAL LIGAQRVAED QMDSPVADDD  120
SSGGSPHRGG GPPLKKGPWT SAEDAILVDY VKKHGEGNWN AVQKNTGLFR CGKSCRLRWA  180
NHLRPNLKKG AFTAEEERLI IQLHFKMRNK WARMAAHLPG RTDNEIKNYW NTRIKRCQRA  240
GLPIYPASVC NQSSNDDQQG SSDFNCGENL SNDLLNGNGL YLPDFTCDNF IANSEALSYA  300
PQLSAVSISN LLGQSYASKN CSFMDQVNQA GMLKQSDSAL PGLNDTINGV LSSVDQFSND  360
SEKLKRALGF DYLHEANSSS NIIAPFGGAL TGSHAFLNGN LSASRITNGP LKMELPSLQD  420
TESDPNSWLK YTVAPAMQPT ELVDPYLQSP TATLSVKSEC VSPRNSGLLE ELLHESQALR  480
SGKNQQPSVR SSSSSVAQSP SLGSGEQAME PKYEAGAGDT SPHPGNFRPD ALFSGNTADP  540
SVFNNAIAML LGNDMNTECK PDLSDGIVFN SSSWSNMPHA CEMSEFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-301302361106B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. {ECO:0000269|PubMed:9150608}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000029G1950
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By gibberellin in aleurone cells. {ECO:0000269|PubMed:9150608}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519170.0JF951917.1 Triticum aestivum clone TaMYB34 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021313406.10.0transcription factor GAMYB
SwissprotA2WW870.0GAM1_ORYSI; Transcription factor GAMYB
TrEMBLA0A3B6EK120.0A0A3B6EK12_WHEAT; Uncharacterized protein
TrEMBLA0A446NSY10.0A0A446NSY1_TRITD; Uncharacterized protein
STRINGTraes_3B_25320ED72.20.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39473664
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.32e-78myb domain protein 33