PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000028G0940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 285aa    MW: 30699.4 Da    PI: 6.6163
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000028G0940genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.6e-161562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l d++ ++G g+W++I+ + g+ R +k+c++rw +yl
  PH01000028G0940 15 KGLWSPEEDQKLRDYILRYGHGCWSAIPVKAGLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding50.54.9e-1671113448
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++ eE+e    +++ lG++ W+ Iar+++ gRt++++k++w++yl
  PH01000028G0940  71 FSREEEETVMSLHATLGNK-WSQIARHLP-GRTDNEVKNYWNSYL 113
                      899****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-211065IPR009057Homeodomain-like
PROSITE profilePS5129414.7031062IPR017930Myb domain
SuperFamilySSF466891.36E-2813109IPR009057Homeodomain-like
SMARTSM007171.1E-111464IPR001005SANT/Myb domain
PfamPF002496.2E-141562IPR001005SANT/Myb domain
CDDcd001674.60E-111862No hitNo description
PROSITE profilePS5129424.14563117IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.5E-2566116IPR009057Homeodomain-like
SMARTSM007172.1E-1467115IPR001005SANT/Myb domain
PfamPF002492.8E-1471113IPR001005SANT/Myb domain
CDDcd001671.05E-1171113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGCKTCQKPK VHYRKGLWSP EEDQKLRDYI LRYGHGCWSA IPVKAGLQRN GKSCRLRWIN  60
YLRPGLKHGI FSREEEETVM SLHATLGNKW SQIARHLPGR TDNEVKNYWN SYLKKRVEGA  120
KEPNAADAQQ SKSTDSDVRG SPKPSENGQE RITSPANSDS SEPVESSSAD GSSCLTDPGA  180
AAVRLHAPVL PKVMFADWLD MDYGTSLMAP SLGAGGAFDA SGRSPAQGSS VQVDGPCGAV  240
MDSLHGLGDG GICWGFDETA DQMLMQGGGG FCDLLSMSEF LGIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25151187109B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000028G0940
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0915920.0FP091592.1 Phyllostachys edulis cDNA clone: bphylf055c23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976342.11e-156transcription factor LAF1
TrEMBLK3YDJ91e-155K3YDJ9_SETIT; Uncharacterized protein
STRINGSi012304m1e-155(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.13e-58myb domain protein 18