PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000024G1380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 279aa    MW: 30169.1 Da    PI: 7.6054
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000024G1380genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEde+l  +v+++G g +W + +++ g++R++k+c++rw++yl
  PH01000024G1380 14 RGPWSPEEDEQLRSYVQRHGIGgNWIALPQKAGLNRCGKSCRLRWLNYL 62
                     89******************999************************97 PP

2Myb_DNA-binding40.28.1e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g+ T++Ed+++  + +  G++ W+ Ia++++ gRt++++k++w++
  PH01000024G1380  69 GSYTEQEDQIICSLYNSIGSR-WSIIASKLP-GRTDNDVKNYWNT 111
                      678******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.81966IPR017930Myb domain
SuperFamilySSF466892.88E-2812109IPR009057Homeodomain-like
SMARTSM007176.3E-121364IPR001005SANT/Myb domain
PfamPF002499.0E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-241569IPR009057Homeodomain-like
CDDcd001679.97E-101662No hitNo description
PROSITE profilePS5129415.74867117IPR017930Myb domain
SMARTSM007174.9E-1267115IPR001005SANT/Myb domain
PfamPF002491.1E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2270116IPR009057Homeodomain-like
CDDcd001675.68E-970113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGRAPCCDKA KVKRGPWSPE EDEQLRSYVQ RHGIGGNWIA LPQKAGLNRC GKSCRLRWLN  60
YLRPDIRHGS YTEQEDQIIC SLYNSIGSRW SIIASKLPGR TDNDVKNYWN TKLKKKATVA  120
VQPGTRSQCT SLQPALSPAA SASSSVTSSS GDICFAAMYP PQPLPQGPIH FDPPPPCKPQ  180
TELAPVPPAT VALDVSGDWA STRAASDDVT LDDVFLPDLG CAGEQLLFPY GDLFGGFGGL  240
QDKATLELSA CYFRNMGEMR AASDHSHAKP QGLCDTLT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25141177108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000024G1380
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1084521e-162AK108452.1 Oryza sativa Japonica Group cDNA clone:002-143-C10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654754.11e-122PREDICTED: transcription factor RAX1-like
TrEMBLJ3M9J11e-120J3M9J1_ORYBR; Uncharacterized protein
STRINGOB05G32650.11e-121(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.12e-68myb domain protein 84