PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000014G1850
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 258aa    MW: 27923.2 Da    PI: 7.6626
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000014G1850genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.8e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT  Ed+ l+ ++k +G g W+ ++++ g++R++k+c++rw++yl
  PH01000014G1850 14 RGAWTSKEDDMLASYIKAHGEGKWREVPQRAGLRRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding513.2e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ + +E+el+++++++lG++ W++Ia +++ gRt++++k++w++ 
  PH01000014G1850  67 RGNISDDEEELIIRLHNLLGNR-WSLIAGRLP-GRTDNEIKNYWNST 111
                      7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-23664IPR009057Homeodomain-like
PROSITE profilePS5129416.773961IPR017930Myb domain
SuperFamilySSF466892.54E-2811108IPR009057Homeodomain-like
SMARTSM007172.4E-121363IPR001005SANT/Myb domain
PfamPF002495.3E-151461IPR001005SANT/Myb domain
CDDcd001672.65E-91661No hitNo description
PROSITE profilePS5129424.75762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2365115IPR009057Homeodomain-like
SMARTSM007173.5E-1566114IPR001005SANT/Myb domain
PfamPF002492.7E-1467111IPR001005SANT/Myb domain
CDDcd001679.00E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MGRRACCVKE GVKRGAWTSK EDDMLASYIK AHGEGKWREV PQRAGLRRCG KSCRLRWLNY  60
LRPNIKRGNI SDDEEELIIR LHNLLGNRWS LIAGRLPGRT DNEIKNYWNS TLGRKAGAAS  120
GCGGTRVSTP DGASQTTDAP AVLSNSEPGQ AAPRADPDAG ASRTAPPPAL WAPKAVRCTG  180
GLFFHRETPP PLAEAQTGEV DGDDCSGSSS VTSSTFPAPE PCFSSGHDWM DDVRALASFL  240
ESDEDWVRCQ MAEPRVQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25141167108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000014G1850
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1350191e-116AY135019.1 Zea mays PL transcription factor (pl) mRNA, pl-W22 allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008659144.11e-107anthocyanin regulatory C1 protein-like
SwissprotP102903e-97MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLA0A1E5WII71e-111A0A1E5WII7_9POAL; Anthocyanin regulatory C1 protein
STRINGGRMZM2G005066_P011e-107(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.15e-58myb domain protein 7
Publications ? help Back to Top
  1. Chen B,Wang X,Hu Y,Wang Y,Lin Z
    Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco.
    Mol. Biotechnol., 2004. 26(3): p. 187-92
    [PMID:15004287]
  2. Paz-Ares J,Ghosal D,Saedler H
    Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus.
    EMBO J., 1990. 9(2): p. 315-21
    [PMID:2303027]
  3. Cone KC,Burr FA,Burr B
    Molecular analysis of the maize anthocyanin regulatory locus C1.
    Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5
    [PMID:3025847]
  4. Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H
    The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators.
    EMBO J., 1987. 6(12): p. 3553-8
    [PMID:3428265]
  5. Scheffler B, et al.
    Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene.
    Mol. Gen. Genet., 1994. 242(1): p. 40-8
    [PMID:7904044]
  6. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]
  7. Singer T,Gierl A,Peterson PA
    Three new dominant C1 suppressor alleles in Zea mays.
    Genet. Res., 1998. 71(2): p. 127-32
    [PMID:9717435]