PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000009G0060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 555aa    MW: 59864.4 Da    PI: 4.7238
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000009G0060genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27e-174289148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +lvd+vk++G g+W+++ +  g+ R++k+c++rw ++l
  PH01000009G0060 42 KGPWTAAEDAILVDYVKKHGEGNWNAVQKNTGLFRCGKSCRLRWANHL 89
                     79******************************************9986 PP

2Myb_DNA-binding513.4e-1695138146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ l+++++ ++G++ W++ a++++ gRt++++k++w++
  PH01000009G0060  95 KGAFTAEEERLIIQLHSKMGNK-WARMAAHLP-GRTDNEIKNYWNT 138
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0016936.1E-2651554IPR016310Transcription factor, GAMYB
PROSITE profilePS5129417.0223789IPR017930Myb domain
SuperFamilySSF466894.12E-3139136IPR009057Homeodomain-like
SMARTSM007175.7E-154191IPR001005SANT/Myb domain
PfamPF002494.9E-154289IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-244396IPR009057Homeodomain-like
CDDcd001678.61E-124489No hitNo description
PROSITE profilePS5129425.02690144IPR017930Myb domain
SMARTSM007176.3E-1794142IPR001005SANT/Myb domain
PfamPF002493.8E-1595138IPR001005SANT/Myb domain
CDDcd001672.21E-1297138No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2597142IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MYGVKSESDC EMIHQDQMDS PVADDGSSGG SPHRGGGPPL KKGPWTAAED AILVDYVKKH  60
GEGNWNAVQK NTGLFRCGKS CRLRWANHLR PNLKKGAFTA EEERLIIQLH SKMGNKWARM  120
AAHLPGRTDN EIKNYWNTRI KRCQRAGLPI YPASVCNQSS NEDQQGSSDF NCGENLSNDL  180
LNGSGLYLPD FTCDNFIANS EALSYAPQLS AVSISNLLGQ SFASKNCSFM DQVNQTGMLK  240
QADSVLPGLS DTINGVLSSV DQFSNDSEKL MQALGFDYLH EANSSSKIIA PFGGALTGSH  300
AFLNGNLSAS RPTNGPLKME LPSLQDTESD PSSWLKYTVA PAMQAIELVD PYLQSPTATL  360
SVKSQCVSPR NSGLLEELLH ESQALRSGKN QQPSVRSSSS SAGTPCDTTV VSPEFDLCQE  420
YWEEHPSSFL NEYAPFSGNS FTESTPPVSA ASTDMFQLSK ISPAQSPSLG SGEQAIEPKY  480
DPGAGDTSPH PENFRPDALF SGYTVDPSIF NNAIAMLLGN DMNTECKPDL GDGIASNSSS  540
WSNMSHACEM SEFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-33361421106B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. {ECO:0000269|PubMed:9150608}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000009G0060
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By gibberellin in aleurone cells. {ECO:0000269|PubMed:9150608}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8308820.0CT830882.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA246D08, full insert sequence.
GenBankCT8308840.0CT830884.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA248K02, full insert sequence.
GenBankX983550.0X98355.1 O.sativa mRNA for transcription activator, GAMyb.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644884.10.0PREDICTED: transcription factor GAMYB
RefseqXP_006644885.10.0PREDICTED: transcription factor GAMYB
SwissprotA2WW870.0GAM1_ORYSI; Transcription factor GAMYB
TrEMBLA0A1D8F0J40.0A0A1D8F0J4_9POAL; MYB protein
STRINGOGLUM01G20920.10.0(Oryza glumipatula)
STRINGOB01G43550.10.0(Oryza brachyantha)
STRINGOBART01G34660.20.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39473664
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.14e-81myb domain protein 33