PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000006G2680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 381aa    MW: 40971.9 Da    PI: 9.2278
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000006G2680genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.4e-153683148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+lv +  + G g+W+ +ar  g+ R++k+c++rw +yl
  PH01000006G2680 36 KGLWSPEEDEKLVAYMLRSGQGSWSDVARNAGLQRCGKSCRLRWINYL 83
                     678*******************************************97 PP

2Myb_DNA-binding53.45.8e-1789132146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+v++++ lG++ W+ Ia++++ gRt++++k++w++
  PH01000006G2680  89 RGAFSPQEEELIVNLHAILGNR-WSQIAARLP-GRTDNEIKNFWNS 132
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0293183IPR017930Myb domain
SuperFamilySSF466891.29E-2834130IPR009057Homeodomain-like
SMARTSM007178.7E-113585IPR001005SANT/Myb domain
PfamPF002492.6E-133683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-223790IPR009057Homeodomain-like
CDDcd001674.59E-93983No hitNo description
PROSITE profilePS5129425.44384138IPR017930Myb domain
SMARTSM007175.3E-1688136IPR001005SANT/Myb domain
PfamPF002493.5E-1589132IPR001005SANT/Myb domain
CDDcd001671.78E-1191131No hitNo description
Gene3DG3DSA:1.10.10.609.5E-2691139IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MRKPECPAMK GSGGGAAAGP CGGNGINAAA AVKLRKGLWS PEEDEKLVAY MLRSGQGSWS  60
DVARNAGLQR CGKSCRLRWI NYLRPDLKRG AFSPQEEELI VNLHAILGNR WSQIAARLPG  120
RTDNEIKNFW NSTIKKRLKN SASSSPATTQ CASLPEPKLA VDGGSSCLDL AGLEDGAHHA  180
IKSMWVDSSS SSNSSSSMQS RPSTMAAARS YGGLLPSPSK SAAWRSTLRR RFSTTTHRSS  240
KLQHCIGGGY YGSTRHGPMA MEGGGSFMGG ESSVLYGVPP LSEPIAVEDQ ITIMASSNNP  300
KNNTAETTTL SSNNGSNITD NSSNSNSNKN INISLVSNSV VYWVGHQQQQ QHMSRNVMGE  360
WDLEELMKDV SSLPFLDFQV E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27341385108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000006G2680
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0952220.0FP095222.1 Phyllostachys edulis cDNA clone: bphyem201h24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020177941.11e-154anthocyanin regulatory C1 protein-like
TrEMBLA0A3B6MP681e-153A0A3B6MP68_WHEAT; Uncharacterized protein
TrEMBLA0A453K0B21e-153A0A453K0B2_AEGTS; Uncharacterized protein
TrEMBLM8BN751e-153M8BN75_AEGTA; Transcription factor MYB46
STRINGEMT264551e-153(Aegilops tauschii)
STRINGTraes_5DS_AACA2EBA3.21e-153(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98213545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.13e-65myb domain protein 46