PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000005G1390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 287aa    MW: 31377.4 Da    PI: 6.7021
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000005G1390genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.3e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++q+G+g+W+++++  g+ R+ k+c++rw +yl
  PH01000005G1390 15 KGPWTPEEDIILVSYIQQHGPGNWRSVPENTGLMRCSKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding47.73.6e-1568113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+ +++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  PH01000005G1390  68 RGNFTPHEEGIIIHLQALLGNK-WASIASYLP-QRTDNDIKNYWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.6421066IPR017930Myb domain
SuperFamilySSF466891.72E-3012109IPR009057Homeodomain-like
SMARTSM007177.4E-141464IPR001005SANT/Myb domain
PfamPF002492.3E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-231669IPR009057Homeodomain-like
CDDcd001671.33E-121762No hitNo description
SMARTSM007172.9E-1367115IPR001005SANT/Myb domain
PROSITE profilePS5129419.63767117IPR017930Myb domain
PfamPF002492.2E-1368113IPR001005SANT/Myb domain
CDDcd001674.81E-1070113No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2470117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MGRPPCCDNG VGVKKGPWTP EEDIILVSYI QQHGPGNWRS VPENTGLMRC SKSCRLRWTN  60
YLRPGIKRGN FTPHEEGIII HLQALLGNKW ASIASYLPQR TDNDIKNYWN THLKKKVKRL  120
QAQPDHSFQT STAPNAVASP NYYNPSSTHQ SLEAMPAMAY PSTTTCSTAA SNEAATISKL  180
FQTWMKPSPP PTTNYKAMAA MQEFQDDQEG AAVSITNCKD HLVINDDKSS SSETVAPVVG  240
RGEVDHSAAA ATFSLLENWL LDDMSGQAID GLMEISAGCC ADPIMF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251511727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000005G1390
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1108441e-154AK110844.1 Oryza sativa Japonica Group cDNA clone:002-172-B09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004979484.11e-149transcription factor MYB30
SwissprotB3VTV71e-89MYB60_VITVI; Transcription factor MYB60
TrEMBLK3ZJI01e-148K3ZJI0_SETIT; Uncharacterized protein
STRINGSi026733m1e-148(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.18e-88myb domain protein 60
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]