PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000004G4070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 278aa    MW: 29844.6 Da    PI: 7.2143
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000004G4070genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.42.9e-074087247
                     SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                     g+WT  E + + +a +    +   +W+ +a++++ ++t  ++++++ ++
  PH01000004G4070 40 GAWTLRENKVFEEALATIDRNapnRWEMVAQMLP-RKTVADVVNHYKDL 87
                     79*****************99*************.***********875 PP

2Myb_DNA-binding23.71.1e-071251611147
                      HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      l++ + k++G g+W+ I+r + + Rt+ q+ s+ qky
  PH01000004G4070 125 LFLMGLKKYGRGDWRNISRNFVTSRTPTQVASHAQKY 161
                      588899******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575124No hitNo description
SMARTSM007179.9E-63890IPR001005SANT/Myb domain
SuperFamilySSF466891.15E-94094IPR009057Homeodomain-like
PROSITE profilePS500906.0864088IPR017877Myb-like domain
CDDcd001674.20E-54287No hitNo description
SMARTSM007172125164IPR001005SANT/Myb domain
SuperFamilySSF466895.74E-10125166IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-10125164IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.6E-6126160IPR009057Homeodomain-like
PROSITE profilePS500904.716130162IPR017877Myb-like domain
CDDcd001672.74E-4131162No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MMAKAWMEVL PPPPPPPYFS GQSCWFLPDR RGGGGGGGAG AWTLRENKVF EEALATIDRN  60
APNRWEMVAQ MLPRKTVADV VNHYKDLEND VGFIEAGLVP FPHYSSTSSS SGFNMDWDGG  120
DGGGLFLMGL KKYGRGDWRN ISRNFVTSRT PTQVASHAQK YFIRLNSGGK DKRRSSIHDI  180
TTVNLPDDDE GNPSPSPPSA LTTASTPAVP DQFGALVDAK PPNPPSLGGH RHFMSPLPPG  240
ALGVCSHPYG NVKLEPRSSF VAGTGLGLDD SVLLQMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1437118683RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000004G4070
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1306021e-105AC130602.5 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone B1122D01, complete sequence.
GenBankAP0149611e-105AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126131e-105CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646487.11e-132PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-61DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D9V7X11e-130A0A0D9V7X1_9ORYZ; Uncharacterized protein
TrEMBLJ3L5X71e-130J3L5X7_ORYBR; Uncharacterized protein
STRINGOB01G46330.11e-131(Oryza brachyantha)
STRINGLPERR01G32290.11e-131(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.22e-40MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]