PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000004G1580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 173aa    MW: 19935.1 Da    PI: 8.2344
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000004G1580genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.82.4e-081258145
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     r +W++eEd+ +  a  + + +   +W+++a+ ++ gRt+ +   ++q
  PH01000004G1580 12 RRPWSKEEDKVFESALVLCPEHepyRWTLVASQIP-GRTPQEAWQHYQ 58
                     679*****************99*************.***988766666 PP

2Myb_DNA-binding44.73.1e-14105149347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W++eE+ +++++ +++G g+W+ I+r     Rt+ q+ s+ qky
  PH01000004G1580 105 PWSEEEHRRFLEGLEKYGRGDWRNISRFAVRSRTPTQVASHAQKY 149
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.963765IPR017930Myb domain
SuperFamilySSF466891.1E-11960IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-71061IPR009057Homeodomain-like
SMARTSM007172.4E-41163IPR001005SANT/Myb domain
PfamPF002496.3E-71258IPR001005SANT/Myb domain
CDDcd001674.88E-51452No hitNo description
PROSITE profilePS5129417.82498154IPR017930Myb domain
SuperFamilySSF466892.48E-17100155IPR009057Homeodomain-like
SMARTSM007179.8E-11102152IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.5E-17103153IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.609.5E-12105149IPR009057Homeodomain-like
PfamPF002499.2E-12105149IPR001005SANT/Myb domain
CDDcd001671.61E-10105150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MDFYRAASPV ARRPWSKEED KVFESALVLC PEHEPYRWTL VASQIPGRTP QEAWQHYQAL  60
VADVDLIERG AVDVPGCWDA DDNEDGAPDR RAGKSRVEER RRGIPWSEEE HRRFLEGLEK  120
YGRGDWRNIS RFAVRSRTPT QVASHAQKYF TRQTNAATRD SKRKSIHDIT TP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-131375971RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01000004G1580
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0968780.0FP096878.1 Phyllostachys edulis cDNA clone: bphyem104c18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567296.18e-92transcription factor DIVARICATA
SwissprotQ8S9H76e-45DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A1D8F0J51e-124A0A1D8F0J5_9POAL; MYB protein
STRINGSb03g040730.18e-83(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.28e-49MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]