PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pahal.G01975.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 162aa MW: 17397.5 Da PI: 10.6815 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 97.9 | 9.7e-31 | 11 | 80 | 2 | 71 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekk 71 Fl+k+y ++ed++++++isw+++g++fvv+ + efa+++Lpk+Fkhsnf+SFvRQLn+YgFkkv ++++ Pahal.G01975.1 11 FLTKTYAMVEDPSTDDTISWNDTGTAFVVWRPAEFARDLLPKHFKHSNFSSFVRQLNTYGFKKVVADRDR 80 9***************************************************************988765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 4.1E-32 | 5 | 80 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 1.0E-36 | 7 | 150 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 6.44E-28 | 9 | 78 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 1.9E-26 | 11 | 78 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 4.0E-20 | 11 | 34 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 4.0E-20 | 49 | 61 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PROSITE pattern | PS00434 | 0 | 50 | 74 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 4.0E-20 | 62 | 74 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene3D | G3DSA:1.20.5.170 | 3.2E-4 | 125 | 153 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MASPAAGTPP FLTKTYAMVE DPSTDDTISW NDTGTAFVVW RPAEFARDLL PKHFKHSNFS 60 SFVRQLNTYG FKKVVADRDR RRGRGGGAAI PTGIPIISSP PTSSGGEPAV SSSSPRGSAA 120 GVSGAVAELE EENARLRREN ARLARELARA RRLCDGVRQL VA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ldu_A | 1e-22 | 1 | 75 | 11 | 84 | Heat shock factor protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY344483 | 1e-113 | AY344483.1 Oryza sativa (japonica cultivar-group) heat shock factor RHSF1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025826145.1 | 2e-98 | heat stress transcription factor B-2a-like | ||||
Swissprot | Q7XRX3 | 3e-89 | HFB2A_ORYSJ; Heat stress transcription factor B-2a | ||||
TrEMBL | A0A2T7CYT3 | 4e-97 | A0A2T7CYT3_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T8IDG9 | 4e-97 | A0A2T8IDG9_9POAL; Uncharacterized protein | ||||
STRING | Sb06g025710.1 | 5e-94 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP121 | 37 | 394 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G11660.1 | 2e-36 | HSF family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pahal.G01975.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|