PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E02794.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 323aa    MW: 35006.8 Da    PI: 5.8285
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E02794.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.3e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
   Pahal.E02794.1 14 RGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGLERCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding49.69.3e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E++l++ ++k lG++ W+ Ia+ ++ gRt++++k++w++
   Pahal.E02794.1  67 RGSFSQQEEDLIISLHKILGNR-WSQIASQLP-GRTDNEIKNFWNS 110
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.404961IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-23964IPR009057Homeodomain-like
SuperFamilySSF466895.99E-2911108IPR009057Homeodomain-like
SMARTSM007176.8E-131363IPR001005SANT/Myb domain
PfamPF002492.5E-141461IPR001005SANT/Myb domain
CDDcd001671.01E-111761No hitNo description
PROSITE profilePS5129425.07362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2565116IPR009057Homeodomain-like
SMARTSM007173.9E-1566114IPR001005SANT/Myb domain
PfamPF002492.5E-1467110IPR001005SANT/Myb domain
CDDcd001672.94E-1169109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGREAAATRP KLRRGLWSPE EDEKLYNHII RYGVGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGSF SQQEEDLIIS LHKILGNRWS QIASQLPGRT DNEIKNFWNS CIKKKLRQRG  120
IDPATHKPLE DDEAAANSGE APRDDCKQLS AATDDHCGFA MGAAASSDPL APHSPTVSFD  180
PLSVTNVPAM QGSYGAAHSF RSDNLCDYGG VDAASDGAAA YSAAAYTGSG ADSSSNSNGT  240
WTCGNVVGGE PMPQLDMFGR EAYHQFDPAK YSPWQQHEAA RLHDGVGGAA GFPIRSMSRD  300
LPDSCFDLAR SALEDEFSVD FL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30101163108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPossible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794210.0HF679421.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB15 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025817553.10.0myb-related protein Hv33-like
SwissprotP200271e-77MYB3_HORVU; Myb-related protein Hv33
TrEMBLA0A2S3HV580.0A0A2S3HV58_9POAL; Uncharacterized protein
TrEMBLA0A2T7DL640.0A0A2T7DL64_9POAL; Uncharacterized protein
STRINGSi002220m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.14e-75myb domain protein 86