PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E01559.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 247aa    MW: 27814.2 Da    PI: 5.0347
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E01559.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.24.4e-5561341128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv++yLk+k++g k+el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++vl
  Pahal.E01559.1   6 LPPGFRFHPTDEELVNYYLKRKIHGLKIEL-DIIPEVDLYKCEPWELAdKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVL 99 
                     79****************************.99**************85335566888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +++g+ +g+kktLv+y+grap+g++tdWvmheyrl
  Pahal.E01559.1 100 HHGGRPIGMKKTLVYYRGRAPQGVRTDWVMHEYRL 134
                     *********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-644158IPR003441NAC domain
PROSITE profilePS5100560.2516157IPR003441NAC domain
PfamPF023659.5E-307134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKIHG LKIELDIIPE VDLYKCEPWE LADKSFLPSR  60
DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVLH HGGRPIGMKK TLVYYRGRAP  120
QGVRTDWVMH EYRLDDKDAE DTLPIQDTYA LCRVFKKNAI CTEVDDLQAQ CSMALLEGAC  180
QQLLTSGSQQ EYQTPSPDVP VGSTSGGADN DADKDESWMQ FISDDAWCSS TADGAEESTS  240
CVALAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-52115915170NAC domain-containing protein 19
3swm_B5e-52115915170NAC domain-containing protein 19
3swm_C5e-52115915170NAC domain-containing protein 19
3swm_D5e-52115915170NAC domain-containing protein 19
3swp_A5e-52115915170NAC domain-containing protein 19
3swp_B5e-52115915170NAC domain-containing protein 19
3swp_C5e-52115915170NAC domain-containing protein 19
3swp_D5e-52115915170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280590.0KJ728059.1 Zea mays clone pUT6205 NAC transcription factor (NAC121) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803496.10.0NAC domain-containing protein 86-like
SwissprotA4VCM07e-82NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A2S3H2330.0A0A2S3H233_9POAL; Uncharacterized protein
TrEMBLA0A2T7EVM30.0A0A2T7EVM3_9POAL; Uncharacterized protein
STRINGPavir.Bb02627.1.p1e-179(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-117NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]