PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E01541.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family TCP
Protein Properties Length: 277aa    MW: 29391.8 Da    PI: 8.8469
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E01541.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP93.93.3e-2944111370
             TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                     g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl++a ++i++l+ ++++++
  Pahal.E01541.1  44 GGKDRHSKVKTVKGLRDRRVRLSVPTAIQLYDLQDRLGLNQPSKVVDWLLNAARHEIDKLPPLQFPPQ 111
                     78*************************************************************98887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036347.1E-2745105IPR005333Transcription factor, TCP
PROSITE profilePS5136929.95145103IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MIRGSNQQQA ADEELARKNA AVATSRQWSA QTESRIVRVS RVFGGKDRHS KVKTVKGLRD  60
RRVRLSVPTA IQLYDLQDRL GLNQPSKVVD WLLNAARHEI DKLPPLQFPP QDLMVGHLAP  120
PMPLVHEEKF AHIAAAAALA SDGAKAGQGD VDMDGSGAAG HHMGRFPGGY HRFMGLNNAF  180
GMVSSAMAPY NSYTGEAWNN SSVHDNGGGG GGGGSPQVAA AAAAHHSPFP SLLSLAPGPH  240
QLVFYSSEAD QQFQVDNLGS QSLSLSSARA YHDQAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A2e-2050104155Putative transcription factor PCF6
5zkt_B2e-2050104155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00065PBMTransfer from AT5G60970Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9702170.0EU970217.1 Zea mays clone 342355 TCP family transcription factor containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025814168.10.0transcription factor PCF5-like
RefseqXP_025814169.10.0transcription factor PCF5-like
TrEMBLA0A2S3HRG30.0A0A2S3HRG3_9POAL; Uncharacterized protein
STRINGPavir.J15913.1.p1e-162(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.14e-41TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5