 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pahal.C02957.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 172aa MW: 19750.7 Da PI: 9.905 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 85.7 | 2.7e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtfskRr+g+ KKA E+ vLCdaev v+ifss gkly+y+s
Pahal.C02957.2 9 KRIENSTNRQVTFSKRRAGLVKKAREIGVLCDAEVGVVIFSSGGKLYDYCS 59
79***********************************************96 PP
| |||||||
| 2 | K-box | 62.9 | 1.2e-21 | 71 | 158 | 1 | 88 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88
yq++sgk l+++k++sl+ e++++kke++n+q e+Rhl+GedL+sL+ eL +e++L+++ ++ R+k +++++++ ++ ++ e+e++
Pahal.C02957.2 71 YQTNSGKILWDEKHKSLSAEIDRVKKENDNMQIELRHLKGEDLNSLQPTELIAIEEALQNGQTNQRDKLMDHWRMHKRNGKMLEDEHK 158
89999999*************************************************************9999999999999998876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 3.8E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 32.043 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.57E-33 | 2 | 95 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.95E-42 | 2 | 80 | No hit | No description |
| PRINTS | PR00404 | 4.3E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 9.8E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.3E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.3E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 6.7E-14 | 82 | 163 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 11.317 | 84 | 170 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 172 aa Download sequence Send to blast |
MGRGKIEIKR IENSTNRQVT FSKRRAGLVK KAREIGVLCD AEVGVVIFSS GGKLYDYCSP 60 RTSLSRILEK YQTNSGKILW DEKHKSLSAE IDRVKKENDN MQIELRHLKG EDLNSLQPTE 120 LIAIEEALQN GQTNQRDKLM DHWRMHKRNG KMLEDEHKLL SFRMVILSPS E* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 5e-20 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 5e-20 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 5e-20 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 5e-20 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 5f28_A | 6e-20 | 1 | 86 | 1 | 78 | MEF2C |
| 5f28_B | 6e-20 | 1 | 86 | 1 | 78 | MEF2C |
| 5f28_C | 6e-20 | 1 | 86 | 1 | 78 | MEF2C |
| 5f28_D | 6e-20 | 1 | 86 | 1 | 78 | MEF2C |
| 6c9l_A | 5e-20 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 5e-20 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 5e-20 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 5e-20 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 5e-20 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 5e-20 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the development of floral organs. B-class protein required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS16. {ECO:0000269|PubMed:9869408}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT054277 | 0.0 | BT054277.1 Zea mays full-length cDNA clone ZM_BFb0210A14 mRNA, complete cds. | |||
| GenBank | KJ726930 | 0.0 | KJ726930.1 Zea mays clone pUT3475 MADS transcription factor (MADS29) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025808084.1 | 1e-118 | MADS-box transcription factor 4-like | ||||
| Swissprot | Q40703 | 1e-105 | MADS4_ORYSJ; MADS-box transcription factor 4 | ||||
| TrEMBL | A0A2S3HBW3 | 1e-117 | A0A2S3HBW3_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A2T7EDL9 | 1e-117 | A0A2T7EDL9_9POAL; Uncharacterized protein | ||||
| STRING | Pavir.J00016.1.p | 1e-116 | (Panicum virgatum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G20240.1 | 8e-66 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pahal.C02957.2 |
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|